Protein Classes
Protein Summary
Ligand for members of the frizzled family of seven transmembrane receptors (Probable). Functions in the canonical Wnt signaling pathway that results in activation of transcription factors of the TCF/LEF family (PubMed:20093360, PubMed:21244856, PubMed:24841207, PubMed:26902720). Required for normal embryonic mesoderm development and formation of caudal somites. Required for normal morphogenesis of the developing neural tube (By similarity). Mediates self-renewal of the stem cells at the bottom on intestinal crypts (in vitro) (PubMed:26902720). The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 96% amino acid identity to mouse Wnt3A protein, and 84% to human WNT3 protein, another WNT gene product. Thi ...more
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 545.9 (req: < 5)
Gene RIFs: 142 (req: <= 3)
Antibodies: 567 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 545.9 (req: >= 5)
Gene RIFs: 142 (req: > 3)
Antibodies: 567 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 77
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligands: 16
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 0
Active Ligands (16)
1 – 10 of 16
Pathways (78)
Reactome (14)
KEGG (14)
PathwayCommons (33)
WikiPathways (17)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 5 of 14
Data Source | Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|---|
Reactome | Class B/2 (Secretin family receptors) | ||||
Reactome | Disassembly of the destruction complex and recruitment of AXIN to the membrane | ||||
Reactome | Disease | ||||
Reactome | Diseases of signal transduction | ||||
Reactome | GPCR ligand binding | ||||
Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|
Class B/2 (Secretin family receptors) | ||||
Disassembly of the destruction complex and recruitment of AXIN to the membrane | ||||
Disease | ||||
Diseases of signal transduction | ||||
GPCR ligand binding | ||||
Gene Ontology Terms (89)
Functions (6)
Components (12)
Processes (71)
Items per page:
10
1 – 6 of 6
GO Term | Evidence | Assigned by | ||
---|---|---|---|---|
Inferred from Direct Assay (IDA) | BHF-UCL | |||
Inferred from Physical Interaction (IPI) | ParkinsonsUK-UCL | |||
Inferred from Physical Interaction (IPI) | ParkinsonsUK-UCL | |||
Inferred from Biological aspect of Ancestor (IBA) | GO_Central | |||
Inferred from Electronic Annotation (IEA) | Ensembl | |||
Inferred from Electronic Annotation (IEA) | Ensembl | |||
Protein-Protein Interactions (328)
1 – 10 of 328
WNT3
Novelty: 0.00774336
p_int: 1
Score: 0.951
Data Source: BioPlex,STRINGDB
PPP2R5A
Family: Enzyme
Novelty: 0.07288957
p_int: 0.999999987
p_ni: 1.1e-8
p_wrong: 2e-9
Score: 0.923
Data Source: BioPlex,STRINGDB
PPP2R5B
Family: Enzyme
Novelty: 0.12086911
p_int: 0.999998331
p_ni: 5.2e-8
p_wrong: 0.000001617
Score: 0.928
Data Source: BioPlex,STRINGDB
PPP2R5E
Family: Enzyme
Novelty: 0.09111617
p_int: 0.999997337
p_ni: 0.000002663
Score: 0.913
Data Source: BioPlex,STRINGDB
PPP2R5D
Family: Enzyme
Novelty: 0.07465785
p_int: 0.9990866
p_ni: 0.0009134
Score: 0.912
Data Source: BioPlex,STRINGDB
PPP2R1B
Family: Enzyme
Novelty: 0.06111104
p_int: 0.95936684
p_ni: 0.040633152
p_wrong: 8e-9
Score: 0.919
Data Source: BioPlex,STRINGDB
PPP2R2D
Family: Enzyme
Novelty: 0.10054323
p_int: 0.879673013
p_ni: 0.120326987
Score: 0.156
Data Source: BioPlex,STRINGDB
CANX
Novelty: 0.00135361
p_int: 0.875298024
p_ni: 0.124701976
Score: 0.171
Data Source: BioPlex,STRINGDB
SDF2L1
Novelty: 0.23702262
p_int: 0.851809787
p_ni: 0.148190213
Data Source: BioPlex
FEM1B
Novelty: 0.07122869
p_int: 0.795382409
p_ni: 0.204617567
p_wrong: 2.3e-8
Data Source: BioPlex
Publication Statistics
PubMed Score 545.90
PubMed score by year
PubTator Score 411.37
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYVEIMPSVAEGI
1-70
KIGIQECQHQFRGRRWNCTTVHDSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTAAICGCSS
70-140
RHQGSPGKGWKWGGCSEDIEFGGMVSREFADARENRPDARSAMNRHNNEAGRQAIASHMHLKCKCHGLSG
140-210
SCEVKTCWWSQPDFRAIGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNF
210-280
CEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHT
280-350
CK
350-352
MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYVEIMPSVAEGIKIGIQECQHQFRGRRWNCTTVHDSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTAAICGCSSRHQGSPGKGWKWGGCSEDIEFGGMVSREFADARENRPDARSAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHTCK
Find similar targets by: