You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
WNT3A
Protein Wnt-3a

Protein Summary
Description
Ligand for members of the frizzled family of seven transmembrane receptors (Probable). Functions in the canonical Wnt signaling pathway that results in activation of transcription factors of the TCF/LEF family (PubMed:20093360, PubMed:21244856, PubMed:24841207, PubMed:26902720). Required for normal embryonic mesoderm development and formation of caudal somites. Required for normal morphogenesis of the developing neural tube (By similarity). Mediates self-renewal of the stem cells at the bottom on intestinal crypts (in vitro) (PubMed:26902720). The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 96% amino acid identity to mouse Wnt3A protein, and 84% to human WNT3 protein, another WNT gene product. Thi ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000284523
  • ENSP00000284523
  • ENSG00000154342
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
biological term
0.86
pathway
0.7
PubMedID
0.68
cellular component
0.66


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 545.9   (req: < 5)
Gene RIFs: 142   (req: <= 3)
Antibodies: 567   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 545.9   (req: >= 5)
Gene RIFs: 142   (req: > 3)
Antibodies: 567   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 77
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 16
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (78)
Class B/2 (Secretin family receptors) (R-HSA-373080)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 14
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class B/2 (Secretin family receptors)
Reactome
Disassembly of the destruction complex and recruitment of AXIN to the membrane
Reactome
Disease
Reactome
Diseases of signal transduction
Reactome
GPCR ligand binding
Name
Explore in Pharos
Explore in Source
Class B/2 (Secretin family receptors)
Disassembly of the destruction complex and recruitment of AXIN to the membrane
Disease
Diseases of signal transduction
GPCR ligand binding
Gene Ontology Terms (89)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Physical Interaction (IPI)
ParkinsonsUK-UCL
Inferred from Physical Interaction (IPI)
ParkinsonsUK-UCL
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (328)
1 – 10 of 328
WNT3
Tchem
Novelty: 0.00774336
p_int: 1
Score: 0.951
Data Source: BioPlex,STRINGDB
PPP2R5A
Tchem
Family: Enzyme
Novelty: 0.07288957
p_int: 0.999999987
p_ni: 1.1e-8
p_wrong: 2e-9
Score: 0.923
Data Source: BioPlex,STRINGDB
PPP2R5B
Tbio
Family: Enzyme
Novelty: 0.12086911
p_int: 0.999998331
p_ni: 5.2e-8
p_wrong: 0.000001617
Score: 0.928
Data Source: BioPlex,STRINGDB
PPP2R5E
Tbio
Family: Enzyme
Novelty: 0.09111617
p_int: 0.999997337
p_ni: 0.000002663
Score: 0.913
Data Source: BioPlex,STRINGDB
PPP2R5D
Tbio
Family: Enzyme
Novelty: 0.07465785
p_int: 0.9990866
p_ni: 0.0009134
Score: 0.912
Data Source: BioPlex,STRINGDB
PPP2R1B
Tbio
Family: Enzyme
Novelty: 0.06111104
p_int: 0.95936684
p_ni: 0.040633152
p_wrong: 8e-9
Score: 0.919
Data Source: BioPlex,STRINGDB
PPP2R2D
Tbio
Family: Enzyme
Novelty: 0.10054323
p_int: 0.879673013
p_ni: 0.120326987
Score: 0.156
Data Source: BioPlex,STRINGDB
CANX
Tbio
Novelty: 0.00135361
p_int: 0.875298024
p_ni: 0.124701976
Score: 0.171
Data Source: BioPlex,STRINGDB
SDF2L1
Tbio
Novelty: 0.23702262
p_int: 0.851809787
p_ni: 0.148190213
Data Source: BioPlex
FEM1B
Tbio
Novelty: 0.07122869
p_int: 0.795382409
p_ni: 0.204617567
p_wrong: 2.3e-8
Data Source: BioPlex
Publication Statistics
PubMed Score  545.90

PubMed score by year
PubTator Score  411.37

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYVEIMPSVAEGI
1-70
KIGIQECQHQFRGRRWNCTTVHDSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTAAICGCSS
70-140
RHQGSPGKGWKWGGCSEDIEFGGMVSREFADARENRPDARSAMNRHNNEAGRQAIASHMHLKCKCHGLSG
140-210
SCEVKTCWWSQPDFRAIGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNF
210-280
CEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHT
280-350
CK
350-352
MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYVEIMPSVAEGIKIGIQECQHQFRGRRWNCTTVHDSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTAAICGCSSRHQGSPGKGWKWGGCSEDIEFGGMVSREFADARENRPDARSAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHTCK