You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
SH3BGR
SH3 domain-binding glutamic acid-rich protein

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000333634
  • ENSP00000332513
  • ENSG00000185437
  • ENST00000380631
  • ENSP00000370005
  • ENST00000380634
  • ENSP00000370008
  • ENST00000380637
  • ENSP00000370011

Symbol
  • 21-GARP
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.82
small molecule perturbation
0.61
gene perturbation
0.58
transcription factor binding site profile
0.54
tissue sample
0.49


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.04   (req: < 5)
Gene RIFs: 3   (req: <= 3)
Antibodies: 163   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.04   (req: >= 5)
Gene RIFs: 3   (req: > 3)
Antibodies: 163   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (4)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (37)
1 – 10 of 37
DCP1B
Tdark
Novelty: 0.54634146
p_int: 0.999846086
p_ni: 0.000153914
Score: 0.221
Data Source: BioPlex,STRINGDB
DEFB127
Tbio
Novelty: 0.21093001
p_int: 0.995441226
p_ni: 0.004558766
p_wrong: 8e-9
Score: 0.193
Data Source: BioPlex,STRINGDB
IGF2BP3
Tbio
Novelty: 0.00583342
p_int: 0.967509573
p_ni: 0.032490427
Score: 0.309
Data Source: BioPlex,STRINGDB
HMGN1
Tbio
Novelty: 0.00524638
Score: 0.8
Data Source: STRINGDB
PSMG1
Tbio
Novelty: 0.11758926
Score: 0.757
Data Source: STRINGDB
CNGB1
Tbio
Family: IC
Novelty: 0.01343158
Score: 0.755
Data Source: STRINGDB
EGFR
Tclin
Family: Kinase
Novelty: 0.0000974
Score: 0.753
Data Source: STRINGDB
RIPPLY3
Tdark
Novelty: 0.20134228
Score: 0.696
Data Source: STRINGDB
KCNJ6
Tchem
Family: IC
Novelty: 0.00501806
Score: 0.674
Data Source: STRINGDB
WRB
Tbio
Novelty: 0.00957515
Score: 0.662
Data Source: STRINGDB
Publication Statistics
PubMed Score  4.04

PubMed score by year
PubTator Score  6.24

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPLLLLGETEPLKLERDCRSPVDPWAAASPDLALACLCHCQDLSSGAFPDRGVLGGVLFPTVEMVIKVFV
1-70
ATSSGSIAIRKKQQEVVGFLEANKIDFKELDIAGDEDNRRWMRENVPGEKKPQNGIPLPPQIFNEEQYCG
70-140
DFDSFFSAKEENIIYSFLGLAPPPDSKGSEKAEEGGETEAQKEGSEDVGNLPEAQEKNEEEGETATEETE
140-210
EIAMEGAEGEAEEEEETAEGEEPGEDEDS
210-239
MPLLLLGETEPLKLERDCRSPVDPWAAASPDLALACLCHCQDLSSGAFPDRGVLGGVLFPTVEMVIKVFVATSSGSIAIRKKQQEVVGFLEANKIDFKELDIAGDEDNRRWMRENVPGEKKPQNGIPLPPQIFNEEQYCGDFDSFFSAKEENIIYSFLGLAPPPDSKGSEKAEEGGETEAQKEGSEDVGNLPEAQEKNEEEGETATEETEEIAMEGAEGEAEEEEETAEGEEPGEDEDS