You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
XG
Glycoprotein Xg

Protein Summary
Description
This gene encodes the XG blood group antigen, and is located at the pseudoautosomal boundary on the short (p) arm of chromosome X. The three 5' exons reside in the pseudoautosomal region and the remaining exons within the X-specific end. A truncated copy of this gene is found on the Y chromosome at the pseudoautosomal boundary. It is transcribed, but not expected to make a Y-chromosome specific gene product. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000381174
  • ENSP00000370566
  • ENSG00000124343
  • ENST00000644266
  • ENSP00000494087

Symbol
  • PBDX
  • PBDX
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
microRNA
0.98
cell type or tissue
0.8
disease
0.66
tissue sample
0.57
cell line
0.51


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 56.08   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 42   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 56.08   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 42   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (29)
1 – 10 of 29
CD99
Tbio
Novelty: 0.0022425
Score: 0.8
Data Source: STRINGDB
TRAPPC2B
Tdark
Novelty: 0.02535505
Score: 0.642
Data Source: STRINGDB
ASMT
Tbio
Family: Enzyme
Novelty: 0.00313422
Score: 0.623
Data Source: STRINGDB
TRAPPC2
Tbio
Novelty: 0.01745001
Score: 0.623
Data Source: STRINGDB
CRYZL1
Tbio
Family: Enzyme
Novelty: 0.03945638
Score: 0.616
Data Source: STRINGDB
CD99L2
Tbio
Novelty: 0.16202141
Score: 0.585
Data Source: STRINGDB
ARSD
Tbio
Family: Enzyme
Novelty: 0.00669026
Score: 0.55
Data Source: STRINGDB
STS
Tchem
Family: Enzyme
Novelty: 0.0020382
Score: 0.547
Data Source: STRINGDB
ARSH
Tbio
Family: Enzyme
Novelty: 0.00554685
Score: 0.547
Data Source: STRINGDB
MAOB
Tclin
Family: Enzyme
Novelty: 0.00036833
Score: 0.54
Data Source: STRINGDB
Publication Statistics
PubMed Score  56.08

PubMed score by year
PubTator Score  39.67

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MESWWGLPCLAFLCFLMHARGQRDFDLADALDDPEPTKKPNSDIYPKPKPPYYPQPENPDSGGNIYPRPK
1-70
PRPQPQPGNSGNSGGYFNDVDRDDGRYPPRPRPRPPAGGGGGGYSSYGNSDNTHGGDHHSTYGNPEGNMV
70-140
AKIVSPIVSVVVVTLLGAAASYFKLNNRRNCFRTHEPENV
140-180
MESWWGLPCLAFLCFLMHARGQRDFDLADALDDPEPTKKPNSDIYPKPKPPYYPQPENPDSGGNIYPRPKPRPQPQPGNSGNSGGYFNDVDRDDGRYPPRPRPRPPAGGGGGGYSSYGNSDNTHGGDHHSTYGNPEGNMVAKIVSPIVSVVVVTLLGAAASYFKLNNRRNCFRTHEPENV