You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SEC13
Protein SEC13 homolog

Protein Summary
Description
Functions as a component of the nuclear pore complex (NPC) and the COPII coat. At the endoplasmic reticulum, SEC13 is involved in the biogenesis of COPII-coated vesicles (PubMed:8972206). Required for the exit of adipsin (CFD/ADN), an adipocyte-secreted protein from the endoplasmic reticulum (By similarity). As a component of the GATOR subcomplex GATOR2, functions within the amino acid-sensing branch of the TORC1 signaling pathway. Indirectly activates mTORC1 and the TORC1 signaling pathway through the inhibition of the GATOR1 subcomplex (PubMed:23723238). It is negatively regulated by the upstream amino acid sensors SESN2 and CASTOR1 (PubMed:25457612, PubMed:27487210). The protein encoded by this gene belongs to the SEC13 family of WD-repeat proteins. It is a constituent of the endoplasmic reticulum and the nuclear pore complex. It has similarity to the yeast SEC13 protein, which is required for vesicle biogenesis from endoplasmic reticulum during the transport of proteins. Multiple a ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000337354
  • ENSP00000336566
  • ENSG00000157020
  • ENST00000350697
  • ENSP00000312122
  • ENST00000383801
  • ENSP00000373312
  • ENST00000397109
  • ENSP00000380298

Symbol
  • D3S1231E
  • SEC13A
  • SEC13L1
  • SEC13R
  • SEC13R
  • npp-20
  • SEC13L1
  • D3S1231E
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
1
virus perturbation
0.98
cellular component
0.82
transcription factor binding site profile
0.82
pathway
0.67


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 99.47   (req: < 5)
Gene RIFs: 9   (req: <= 3)
Antibodies: 219   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 99.47   (req: >= 5)
Gene RIFs: 9   (req: > 3)
Antibodies: 219   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 16
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (102)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 91
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Reactome
Amplification of signal from the kinetochores
Reactome
Antigen Presentation: Folding, assembly and peptide loading of class I MHC
Reactome
Antiviral mechanism by IFN-stimulated genes
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Amplification of signal from the kinetochores
Antigen Presentation: Folding, assembly and peptide loading of class I MHC
Antiviral mechanism by IFN-stimulated genes
Gene Ontology Terms (28)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (474)
1 – 10 of 474
WDR24
Tdark
Novelty: 1.44736842
p_int: 0.999999172
p_ni: 8.28e-7
Score: 0.999
Data Source: BioPlex,STRINGDB
MIOS
Tdark
Novelty: 0.03378873
p_int: 0.999996345
p_ni: 0.000003655
Score: 0.999
Data Source: BioPlex,STRINGDB
PPWD1
Tbio
Family: Enzyme
Novelty: 0.09375
p_int: 0.999992429
p_ni: 0.000007571
Score: 0.243
Data Source: BioPlex,STRINGDB
WDR59
Tdark
Novelty: 0.27755881
p_int: 0.999983662
p_ni: 0.000016338
Score: 0.996
Data Source: BioPlex,STRINGDB
SPDL1
Tbio
Novelty: 0.02478116
p_int: 0.999885965
p_ni: 0.000114035
Score: 0.912
Data Source: BioPlex,STRINGDB
SESN2
Tbio
Novelty: 0.00594978
p_int: 0.999834631
p_ni: 0.000133122
p_wrong: 0.000032247
Score: 0.902
Data Source: BioPlex,STRINGDB
BCR
Tclin
Novelty: 0.00100632
p_int: 0.999235738
p_ni: 0.000764262
Score: 0.158
Data Source: BioPlex,STRINGDB
SEC31A
Tbio
Novelty: 0.06064315
p_int: 0.999093127
p_ni: 0.000906873
Score: 0.999
Data Source: BioPlex,Reactome,STRINGDB
NUP98
Tbio
Family: Enzyme
Novelty: 0.0050582
p_int: 0.998866281
p_ni: 0.001133719
Score: 0.999
Data Source: BioPlex,STRINGDB
NUP85
Tbio
Novelty: 0.0574634
p_int: 0.997106669
p_ni: 0.002893331
Score: 0.999
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  99.47

PubMed score by year
PubTator Score  52.15

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMY
1-70
GNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQW
70-140
EVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEA
140-210
HSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVS
210-280
GGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNEQ
280-322
MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNEQ