You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
ADK
Adenosine kinase

Protein Summary
Description
ATP dependent phosphorylation of adenosine and other related nucleoside analogs to monophosphate derivatives. Serves as a potential regulator of concentrations of extracellular adenosine and intracellular adenine nucleotides. This gene an enzyme which catalyzes the transfer of the gamma-phosphate from ATP to adenosine, thereby serving as a regulator of concentrations of both extracellular adenosine and intracellular adenine nucleotides. Adenosine has widespread effects on the cardiovascular, nervous, respiratory, and immune systems and inhibitors of the enzyme could play an important pharmacological role in increasing intravascular adenosine concentrations and acting as anti-inflammatory agents. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000286621
  • ENSP00000286621
  • ENSG00000156110
  • ENST00000372734
  • ENSP00000361819
  • ENST00000539909
  • ENSP00000443965
  • ENST00000541550
  • ENSP00000438321

Symbol
  • AK
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
1
kinase perturbation
0.99
molecular function
0.96
transcription factor binding site profile
0.96
biological process
0.91


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 366.33   (req: < 5)
Gene RIFs: 15   (req: <= 3)
Antibodies: 405   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 366.33   (req: >= 5)
Gene RIFs: 15   (req: > 3)
Antibodies: 405   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 142
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (581)
Metabolism (R-HSA-1430728)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism
Reactome
Metabolism of nucleotides
Reactome
Nucleotide salvage
Reactome
Purine salvage
Name
Explore in Pharos
Explore in Source
Metabolism
Metabolism of nucleotides
Nucleotide salvage
Purine salvage
Gene Ontology Terms (12)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Experiment (EXP)
Reactome
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (187)
1 – 10 of 187
FGB
Tbio
Novelty: 0.00757235
p_int: 0.999415969
p_ni: 0.0000038
p_wrong: 0.00058023
Score: 0.2
Data Source: BioPlex,STRINGDB
ADA
Tclin
Family: Enzyme
Novelty: 0.00092466
Score: 0.997
Data Source: STRINGDB
APRT
Tbio
Family: Enzyme
Novelty: 0.00447719
Score: 0.992
Data Source: STRINGDB
ADSL
Tbio
Family: Enzyme
Novelty: 0.00038063
Score: 0.989
Data Source: STRINGDB
PNP
Tclin
Family: Enzyme
Novelty: 0.00222396
Score: 0.989
Data Source: STRINGDB
AMPD3
Tchem
Family: Enzyme
Novelty: 0.01389213
Score: 0.98
Data Source: STRINGDB
AK2
Tbio
Family: Kinase
Novelty: 0.00910897
Score: 0.979
Data Source: STRINGDB
AMPD2
Tchem
Family: Enzyme
Novelty: 0.01787589
Score: 0.976
Data Source: STRINGDB
ADA2
Tbio
Family: Enzyme
Novelty: 0.01375983
Score: 0.97
Data Source: STRINGDB
AMPD1
Tchem
Family: Enzyme
Novelty: 0.00584394
Score: 0.97
Data Source: STRINGDB
Publication Statistics
PubMed Score  366.33

PubMed score by year
PubTator Score  248.18

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MAAAEEEPKPKKLKVEAPQALRENILFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELV
1-70
KKFKVEYHAGGSTQNSIKVAQWMIQQPHKAATFFGCIGIDKFGEILKRKAAEAHVDAHYYEQNEQPTGTC
70-140
AACITGDNRSLIANLAAANCYKKEKHLDLEKNWMLVEKARVCYIAGFFLTVSPESVLKVAHHASENNRIF
140-210
TLNLSAPFISQFYKESLMKVMPYVDILFGNETEAATFAREQGFETKDIKEIAKKTQALPKMNSKRQRIVI
210-280
FTQGRDDTIMATESEVTAFAVLDQDQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIIIRR
280-350
TGCTFPEKPDFH
350-362
MAAAEEEPKPKKLKVEAPQALRENILFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSIKVAQWMIQQPHKAATFFGCIGIDKFGEILKRKAAEAHVDAHYYEQNEQPTGTCAACITGDNRSLIANLAAANCYKKEKHLDLEKNWMLVEKARVCYIAGFFLTVSPESVLKVAHHASENNRIFTLNLSAPFISQFYKESLMKVMPYVDILFGNETEAATFAREQGFETKDIKEIAKKTQALPKMNSKRQRIVIFTQGRDDTIMATESEVTAFAVLDQDQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIIIRRTGCTFPEKPDFH