You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
AQP5
Aquaporin-5

Protein Summary
Description
Forms a water-specific channel. Implicated in the generation of saliva, tears, and pulmonary secretions. Required for TRPV4 activation by hypotonicity (PubMed:16571723). Together with TRPV4, controls regulatory volume decrease in salivary epithelial cells (PubMed:16571723). Aquaporin 5 (AQP5) is a water channel protein. Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0). Aquaporin 5 plays a role in the generation of saliva, tears and pulmonary secretions. AQP0, AQP2, AQP5, and AQP6 are closely related and all map to 12q13. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000293599
  • ENSP00000293599
  • ENSG00000161798

Symbol
  • PPKB
  • AQP-5
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
co-expressed gene
0.99
cellular component
0.77
gene perturbation
0.77
molecular function
0.67
kinase perturbation
0.66


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 511.22   (req: < 5)
Gene RIFs: 101   (req: <= 3)
Antibodies: 290   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 511.22   (req: >= 5)
Gene RIFs: 101   (req: > 3)
Antibodies: 290   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (5)
Aquaporin-mediated transport (R-HSA-445717)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Aquaporin-mediated transport
Reactome
Passive transport by Aquaporins
Reactome
Transport of small molecules
Name
Explore in Pharos
Explore in Source
Aquaporin-mediated transport
Passive transport by Aquaporins
Transport of small molecules
Gene Ontology Terms (17)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
IntAct
Protein-Protein Interactions (53)
1 – 10 of 53
STX4
Tbio
Novelty: 0.01072491
Score: 0.919
Data Source: STRINGDB
EXOC4
Tbio
Novelty: 0.02000189
Score: 0.906
Data Source: STRINGDB
EXOC3
Tbio
Novelty: 0.01423005
Score: 0.902
Data Source: STRINGDB
AQP10
Tbio
Novelty: 0.05001269
Score: 0.882
Data Source: STRINGDB
AQP12A
Tbio
Novelty: 0.0840303
Score: 0.846
Data Source: STRINGDB
AQP11
Tbio
Novelty: 0.02650569
Score: 0.814
Data Source: STRINGDB
SFTPC
Tbio
Novelty: 0.00174879
Score: 0.773
Data Source: STRINGDB
TRPV4
Tchem
Family: IC
Novelty: 0.00123393
Score: 0.758
Data Source: STRINGDB
SCGB1A1
Tbio
Novelty: 0.00118669
Score: 0.692
Data Source: STRINGDB
SFTPA1
Tbio
Novelty: 0.00575742
Score: 0.663
Data Source: STRINGDB
Publication Statistics
PubMed Score  511.22

PubMed score by year
PubTator Score  235.86

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKKEVCSVAFLKAVFAEFLATLIFVFFGLGSALKWPSALPTILQIALAFGLAIGTLAQALGPVSGGHINP
1-70
AITLALLVGNQISLLRAFFYVAAQLVGAIAGAGILYGVAPLNARGNLAVNALNNNTTQGQAMVVELILTF
70-140
QLALCIFASTDSRRTSPVGSPALSIGLSVTLGHLVGIYFTGCSMNPARSFGPAVVMNRFSPAHWVFWVGP
140-210
IVGAVLAAILYFYLLFPNSLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTTR
210-265
MKKEVCSVAFLKAVFAEFLATLIFVFFGLGSALKWPSALPTILQIALAFGLAIGTLAQALGPVSGGHINPAITLALLVGNQISLLRAFFYVAAQLVGAIAGAGILYGVAPLNARGNLAVNALNNNTTQGQAMVVELILTFQLALCIFASTDSRRTSPVGSPALSIGLSVTLGHLVGIYFTGCSMNPARSFGPAVVMNRFSPAHWVFWVGPIVGAVLAAILYFYLLFPNSLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTTR