You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
EPHA4
Ephrin type-A receptor 4

Protein Summary
Description
Receptor tyrosine kinase which binds membrane-bound ephrin family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Highly promiscuous, it has the unique property among Eph receptors to bind and to be physiologically activated by both GPI-anchored ephrin-A and transmembrane ephrin-B ligands including EFNA1 and EFNB3. Upon activation by ephrin ligands, modulates cell morphology and integrin-dependent cell adhesion through regulation of the Rac, Rap and Rho GTPases activity. Plays an important role in the development of the nervous system controlling different steps of axonal guidance including the establishment of the corticospinal projections. May also control the segregation of motor and sensory axons during neuromuscular circuit development. I ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000281821
  • ENSP00000281821
  • ENSG00000116106
  • ENST00000409938
  • ENSP00000386829

Symbol
  • HEK8
  • SEK
  • TYRO1
  • EK8
  • SEK
  • HEK8
  • TYRO1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
1
protein domain
1
biological process
0.97
PubMedID
0.97
transcription factor perturbation
0.96


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 270.53   (req: < 5)
Gene RIFs: 41   (req: <= 3)
Antibodies: 635   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 270.53   (req: >= 5)
Gene RIFs: 41   (req: > 3)
Antibodies: 635   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 48
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 6
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 2
Protein Data Bank (15)
1 – 5 of 15
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (11)
Axon guidance (R-HSA-422475)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Axon guidance
Reactome
Developmental Biology
Reactome
EPH-Ephrin signaling
Reactome
EPH-ephrin mediated repulsion of cells
Name
Explore in Pharos
Explore in Source
Axon guidance
Developmental Biology
EPH-Ephrin signaling
EPH-ephrin mediated repulsion of cells
Gene Ontology Terms (73)
Items per page:
10
1 – 10 of 13
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
ARUK-UCL
Inferred from Genetic Interaction (IGI)
ARUK-UCL
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Traceable Author Statement (TAS)
ARUK-UCL
Protein-Protein Interactions (184)
1 – 10 of 184
EFNA5
Tbio
Novelty: 0.00173565
p_int: 0.999418723
p_ni: 0.000581277
Score: 0.999
Data Source: BioPlex,STRINGDB
IARS2
Tbio
Family: Enzyme
Novelty: 0.01156578
p_int: 0.99924068
p_ni: 0.00075932
Data Source: BioPlex
CALML3
Tbio
Novelty: 0.04654771
p_int: 0.99884891
p_ni: 0.001151028
p_wrong: 6.3e-8
Data Source: BioPlex
COPZ1
Tbio
Novelty: 0.0203377
p_int: 0.998231872
p_ni: 0.001768128
p_wrong: 1e-9
Data Source: BioPlex
RSPH14
Tdark
Novelty: 1.73764906
p_int: 0.99772695
p_ni: 0.00227305
Score: 0.199
Data Source: BioPlex,STRINGDB
CPA5
Tbio
Family: Enzyme
Novelty: 0.06404525
p_int: 0.992916647
p_ni: 0.007083353
Data Source: BioPlex
TBC1D22A
Tbio
Novelty: 0.42217484
p_int: 0.992244291
p_ni: 0.007755709
Score: 0.154
Data Source: BioPlex,STRINGDB
CTLA4
Tclin
Novelty: 0.00017405
p_int: 0.987411446
p_ni: 0.012588513
p_wrong: 4e-8
Data Source: BioPlex
TUBB
Tclin
Novelty: 0.00489923
p_int: 0.98695319
p_ni: 0.01304681
Score: 0.158
Data Source: BioPlex,STRINGDB
TMEM9
Tbio
Novelty: 0.1192335
p_int: 0.98106841
p_ni: 0.01893159
Data Source: BioPlex
Publication Statistics
PubMed Score  270.53

PubMed score by year
PubTator Score  116.72

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MAGIFYFALFSCLFGICDAVTGSRVYPANEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTY
1-70
QVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIREN
70-140
QFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKCPLTVRN
140-210
LAQFPDTITGADTSSLVEVRGSCVNNSEEKDVPKMYCGADGEWLVPIGNCLCNAGHEERSGECQACKIGY
210-280
YKALSTDATCAKCPPHSYSVWEGATSCTCDRGFFRADNDAASMPCTRPPSAPLNLISNVNETSVNLEWSS
280-350
PQNTGGRQDISYNVVCKKCGAGDPSKCRPCGSGVHYTPQQNGLKTTKVSITDLLAHTNYTFEIWAVNGVS
350-420
KYNPNPDQSVSVTVTTNQAAPSSIALVQAKEVTRYSVALAWLEPDRPNGVILEYEVKYYEKDQNERSYRI
420-490
VRTAARNTDIKGLNPLTSYVFHVRARTAAGYGDFSEPLEVTTNTVPSRIIGDGANSTVLLVSVSGSVVLV
490-560
VILIAAFVISRRRSKYSKAKQEADEEKHLNQGVRTYVDPFTYEDPNQAVREFAKEIDASCIKIEKVIGVG
560-630
EFGEVCSGRLKVPGKREICVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITE
630-700
YMENGSLDAFLRKNDGRFTVIQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRV
700-770
LEDDPEAAYTTRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEG
770-840
YRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNPNSLKRTGTESSRPNTALLDPSSPEF
840-910
SAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHVNQEDLARIGITAITHQNKILSSVQAMRTQMQQMH
910-980
GRMVPV
980-986
MAGIFYFALFSCLFGICDAVTGSRVYPANEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCVNNSEEKDVPKMYCGADGEWLVPIGNCLCNAGHEERSGECQACKIGYYKALSTDATCAKCPPHSYSVWEGATSCTCDRGFFRADNDAASMPCTRPPSAPLNLISNVNETSVNLEWSSPQNTGGRQDISYNVVCKKCGAGDPSKCRPCGSGVHYTPQQNGLKTTKVSITDLLAHTNYTFEIWAVNGVSKYNPNPDQSVSVTVTTNQAAPSSIALVQAKEVTRYSVALAWLEPDRPNGVILEYEVKYYEKDQNERSYRIVRTAARNTDIKGLNPLTSYVFHVRARTAAGYGDFSEPLEVTTNTVPSRIIGDGANSTVLLVSVSGSVVLVVILIAAFVISRRRSKYSKAKQEADEEKHLNQGVRTYVDPFTYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVIQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLEDDPEAAYTTRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNPNSLKRTGTESSRPNTALLDPSSPEFSAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHVNQEDLARIGITAITHQNKILSSVQAMRTQMQQMHGRMVPV