You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
EPHB4
Ephrin type-B receptor 4

Protein Summary
Description
Receptor tyrosine kinase which binds promiscuously transmembrane ephrin-B family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Together with its cognate ligand/functional ligand EFNB2 plays a central role in heart morphogenesis and angiogenesis through regulation of cell adhesion and cell migration. EPHB4-mediated forward signaling controls cellular repulsion and segregation form EFNB2-expressing cells. Plays also a role in postnatal blood vessel remodeling, morphogenesis and permeability and is thus important in the context of tumor angiogenesis. Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divi ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000358173
  • ENSP00000350896
  • ENSG00000196411
  • ENST00000616502
  • ENSP00000482702

Symbol
  • HTK
  • MYK1
  • TYRO11
  • HTK
  • MYK1
  • HFASD
  • CMAVM2
  • LMPHM7
  • TYRO11
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
1
molecular function
0.98
PubMedID
0.86
transcription factor binding site profile
0.83
kinase perturbation
0.81


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 340.26   (req: < 5)
Gene RIFs: 100   (req: <= 3)
Antibodies: 627   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 340.26   (req: >= 5)
Gene RIFs: 100   (req: > 3)
Antibodies: 627   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 16
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 73
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 2
Protein Data Bank (23)
1 – 5 of 23
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (25)
Axon guidance (R-HSA-422475)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Axon guidance
Reactome
Developmental Biology
Reactome
EPH-Ephrin signaling
Reactome
EPH-ephrin mediated repulsion of cells
Reactome
Ephrin signaling
Name
Explore in Pharos
Explore in Source
Axon guidance
Developmental Biology
EPH-Ephrin signaling
EPH-ephrin mediated repulsion of cells
Ephrin signaling
Gene Ontology Terms (24)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Experiment (EXP)
Reactome
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (175)
1 – 10 of 175
EFNB2
Tbio
Novelty: 0.00309066
p_int: 0.999998976
p_ni: 0.00000102
p_wrong: 4e-9
Score: 0.999
Data Source: BioPlex,STRINGDB
SCGB2A2
Tbio
Novelty: 0.01762536
p_int: 0.997616025
p_ni: 0.002383948
p_wrong: 2.7e-8
Score: 0.198
Data Source: BioPlex,STRINGDB
TCTN2
Tdark
Novelty: 0.19568118
p_int: 0.996846043
p_ni: 0.003153951
p_wrong: 7e-9
Data Source: BioPlex
SCGB2A1
Tbio
Novelty: 0.00455624
p_int: 0.996237235
p_ni: 0.003762763
p_wrong: 2e-9
Data Source: BioPlex
MANSC1
Tdark
Novelty: 1.42372881
p_int: 0.996172052
p_ni: 0.003827448
p_wrong: 5.01e-7
Data Source: BioPlex
KLRG2
Tdark
Novelty: 0.77419355
p_int: 0.989727321
p_ni: 0.010271095
p_wrong: 0.000001584
Score: 0.172
Data Source: BioPlex,STRINGDB
PCDHGA5
Tdark
p_int: 0.986744476
p_ni: 0.013236317
p_wrong: 0.000019207
Score: 0.172
Data Source: BioPlex,STRINGDB
TMPRSS3
Tbio
Family: Enzyme
Novelty: 0.03356847
p_int: 0.978692288
p_ni: 0.021119659
p_wrong: 0.000188053
Data Source: BioPlex
GABRE
Tclin
Family: IC
Novelty: 0.09719489
p_int: 0.977830344
p_ni: 0.022169655
p_wrong: 1e-9
Data Source: BioPlex
HLA-DRA
Tbio
Novelty: 0.00705028
p_int: 0.977205536
p_ni: 0.022792663
p_wrong: 0.000001801
Data Source: BioPlex
Publication Statistics
PubMed Score  340.26

PubMed score by year
PubTator Score  166.17

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MELRVLLCWASLAAALEETLLNTKLETADLKWVTFPQVDGQWEELSGLDEEQHSVRTYEVCDVQRAPGQA
1-70
HWLRTGWVPRRGAVHVYATLRFTMLECLSLPRAGRSCKETFTVFYYESDADTATALTPAWMENPYIKVDT
70-140
VAAEHLTRKRPGAEATGKVNVKTLRLGPLSKAGFYLAFQDQGACMALLSLHLFYKKCAQLTVNLTRFPET
140-210
VPRELVVPVAGSCVVDAVPAPGPSPSLYCREDGQWAEQPVTGCSCAPGFEAAEGNTKCRACAQGTFKPLS
210-280
GEGSCQPCPANSHSNTIGSAVCQCRVGYFRARTDPRGAPCTTPPSAPRSVVSRLNGSSLHLEWSAPLESG
280-350
GREDLTYALRCRECRPGGSCAPCGGDLTFDPGPRDLVEPWVVVRGLRPDFTYTFEVTALNGVSSLATGPV
350-420
PFEPVNVTTDREVPPAVSDIRVTRSSPSSLSLAWAVPRAPSGAVLDYEVKYHEKGAEGPSSVRFLKTSEN
420-490
RAELRGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLDESEGWREQLALIAGTAVVGVVLVLVVIVVAV
490-560
LCLRKQSNGREAEYSDKHGQYLIGHGTKVYIDPFTYEDPNEAVREFAKEIDVSYVKIEEVIGAGEFGEVC
560-630
RGRLKAPGKKESCVAIKTLKGGYTERQRREFLSEASIMGQFEHPNIIRLEGVVTNSMPVMILTEFMENGA
630-700
LDSFLRLNDGQFTVIQLVGMLRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLEENSS
700-770
DPTYTSSLGGKIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLP
770-840
PPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVARENGGASHPLLDQRQPHYSAFG
840-910
SVGEWLRAIKMGRYEESFAAAGFGSFELVSQISAEDLLRIGVTLAGHQKKILASVQHMKSQAKPGTPGGT
910-980
GGPAPQY
980-987
MELRVLLCWASLAAALEETLLNTKLETADLKWVTFPQVDGQWEELSGLDEEQHSVRTYEVCDVQRAPGQAHWLRTGWVPRRGAVHVYATLRFTMLECLSLPRAGRSCKETFTVFYYESDADTATALTPAWMENPYIKVDTVAAEHLTRKRPGAEATGKVNVKTLRLGPLSKAGFYLAFQDQGACMALLSLHLFYKKCAQLTVNLTRFPETVPRELVVPVAGSCVVDAVPAPGPSPSLYCREDGQWAEQPVTGCSCAPGFEAAEGNTKCRACAQGTFKPLSGEGSCQPCPANSHSNTIGSAVCQCRVGYFRARTDPRGAPCTTPPSAPRSVVSRLNGSSLHLEWSAPLESGGREDLTYALRCRECRPGGSCAPCGGDLTFDPGPRDLVEPWVVVRGLRPDFTYTFEVTALNGVSSLATGPVPFEPVNVTTDREVPPAVSDIRVTRSSPSSLSLAWAVPRAPSGAVLDYEVKYHEKGAEGPSSVRFLKTSENRAELRGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLDESEGWREQLALIAGTAVVGVVLVLVVIVVAVLCLRKQSNGREAEYSDKHGQYLIGHGTKVYIDPFTYEDPNEAVREFAKEIDVSYVKIEEVIGAGEFGEVCRGRLKAPGKKESCVAIKTLKGGYTERQRREFLSEASIMGQFEHPNIIRLEGVVTNSMPVMILTEFMENGALDSFLRLNDGQFTVIQLVGMLRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLEENSSDPTYTSSLGGKIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVARENGGASHPLLDQRQPHYSAFGSVGEWLRAIKMGRYEESFAAAGFGSFELVSQISAEDLLRIGVTLAGHQKKILASVQHMKSQAKPGTPGGTGGPAPQY