You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SUB1
Activated RNA polymerase II transcriptional coactivator p15

Protein Summary
Description
General coactivator that functions cooperatively with TAFs and mediates functional interactions between upstream activators and the general transcriptional machinery. May be involved in stabilizing the multiprotein transcription complex. Binds single-stranded DNA. Also binds, in vitro, non-specifically to double-stranded DNA (ds DNA).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000265073
  • ENSP00000265073
  • ENSG00000113387
  • ENST00000502897
  • ENSP00000427100
  • ENST00000506237
  • ENSP00000422078
  • ENST00000512913
  • ENSP00000422806
  • ENST00000515355
  • ENSP00000426850

Symbol
  • PC4
  • RPO2TC1
  • P15
  • PC4
  • p14
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.97
kinase perturbation
0.96
transcription factor perturbation
0.96
transcription factor binding site profile
0.84
disease perturbation
0.79


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 305.79   (req: < 5)
Gene RIFs: 27   (req: <= 3)
Antibodies: 241   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 305.79   (req: >= 5)
Gene RIFs: 27   (req: > 3)
Antibodies: 241   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (13)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
IntAct
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (146)
1 – 10 of 146
SUPT5H
Tbio
Novelty: 0.01008831
Score: 0.888
Data Source: STRINGDB
GTF2B
Tbio
Novelty: 0.00228704
Score: 0.883
Data Source: STRINGDB
SYMPK
Tbio
Novelty: 0.00176022
Score: 0.761
Data Source: STRINGDB
LSM5
Tbio
Novelty: 0.09756098
Score: 0.74
Data Source: STRINGDB
POLR2A
Tbio
Family: Enzyme
Novelty: 0.00328577
Score: 0.737
Data Source: STRINGDB
CSTF2
Tbio
Novelty: 0.01665961
Score: 0.715
Data Source: STRINGDB
TBP
Tbio
Novelty: 0.00051191
Score: 0.681
Data Source: STRINGDB
TP53
Tchem
Family: TF
Novelty: 0.00002203
Score: 0.678
Data Source: STRINGDB
TIMM13
Tdark
Family: Enzyme
Novelty: 0.01126365
Score: 0.665
Data Source: STRINGDB
SUPT4H1
Tbio
Novelty: 0.01941463
Score: 0.663
Data Source: STRINGDB
Publication Statistics
PubMed Score  305.79

PubMed score by year
PubTator Score  336.18

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMR
1-70
YVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL
70-127
MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL