You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RCAN1
Calcipressin-1

Protein Summary
Description
Inhibits calcineurin-dependent transcriptional responses by binding to the catalytic domain of calcineurin A (PubMed:12809556). Could play a role during central nervous system development (By similarity). The protein encoded by this gene interacts with calcineurin A and inhibits calcineurin-dependent signaling pathways, possibly affecting central nervous system development. This gene is located in the minimal candidate region for the Down syndrome phenotype, and is overexpressed in the brain of Down syndrome fetuses. Chronic overexpression of this gene may lead to neurofibrillary tangles such as those associated with Alzheimer disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2013]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000313806
  • ENSP00000320768
  • ENSG00000159200
  • ENST00000381132
  • ENSP00000370524
  • ENST00000399272
  • ENSP00000382214
  • ENST00000443408
  • ENSP00000392438
  • ENST00000482533
  • ENSP00000419624
  • ENST00000487990
  • ENSP00000419252
  • ENST00000620920
  • ENSP00000477646

Symbol
  • ADAPT78
  • CSP1
  • DSC1
  • DSCR1
  • CSP1
  • DSC1
  • RCN1
  • DSCR1
  • MCIP1
  • ADAPT78
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase
0.9
transcription factor
0.9
PubMedID
0.89
transcription factor perturbation
0.88
disease perturbation
0.87


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 280.33   (req: < 5)
Gene RIFs: 86   (req: <= 3)
Antibodies: 521   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 280.33   (req: >= 5)
Gene RIFs: 86   (req: > 3)
Antibodies: 521   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (44)
Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
KEGG
Oxytocin signaling pathway
KEGG
Kaposi sarcoma-associated herpesvirus infection
KEGG
Thyroid hormone signaling pathway
Name
Explore in Pharos
Explore in Source
Oxytocin signaling pathway
Kaposi sarcoma-associated herpesvirus infection
Thyroid hormone signaling pathway
Protein-Protein Interactions (83)
1 – 10 of 83
PPP3CA
Tchem
Family: Enzyme
Novelty: 0.00238194
p_int: 1
Score: 0.954
Data Source: BioPlex,STRINGDB
PPP3CC
Tbio
Family: Enzyme
Novelty: 0.04180044
p_int: 1
Score: 0.827
Data Source: BioPlex,STRINGDB
PPP3R2
Tbio
Novelty: 0.0210854
p_int: 0.999999919
p_ni: 4.9e-8
p_wrong: 3.1e-8
Score: 0.368
Data Source: BioPlex,STRINGDB
GSK3A
Tclin
Family: Kinase
Novelty: 0.01538406
p_int: 0.99999773
p_ni: 7.7e-7
p_wrong: 0.000001501
Score: 0.715
Data Source: BioPlex,STRINGDB
PPP3CB
Tbio
Family: Enzyme
Novelty: 0.02520885
p_int: 0.999982418
p_ni: 0.000017582
Score: 0.846
Data Source: BioPlex,STRINGDB
PPP3R1
Tbio
Novelty: 0.00213192
p_int: 0.99997993
p_ni: 0.000020069
Score: 0.885
Data Source: BioPlex,STRINGDB
ARMT1
Tbio
Family: Enzyme
Novelty: 0.28301887
p_int: 0.999956051
p_ni: 0.000043949
Score: 0.269
Data Source: BioPlex,STRINGDB
SRBD1
Tbio
Novelty: 0.34233385
p_int: 0.999946791
p_ni: 0.000053205
p_wrong: 4e-9
Score: 0.694
Data Source: BioPlex,STRINGDB
FAM122A
Tbio
Novelty: 0.76767677
p_int: 0.999875073
p_ni: 0.000014226
p_wrong: 0.000110701
Score: 0.85
Data Source: BioPlex,STRINGDB
CST2
Tbio
Novelty: 0.03317401
p_int: 0.99884303
p_ni: 0.00079259
p_wrong: 0.00036438
Score: 0.186
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  280.33

PubMed score by year
PubTator Score  191.98

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEDGVAGPQLGAAAEAAEAAEARARPGVTLRPFAPLSGAAEADEGGGDWSFIDCEMEEVDLQDLPSATIA
1-70
CHLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQLHKTEFLGKEMKLYF
70-140
AQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPS
140-210
VVVHVCESDQEKEEEEEMERMRRPKPKIIQTRRPEYTPIHLS
210-252
MEDGVAGPQLGAAAEAAEAAEARARPGVTLRPFAPLSGAAEADEGGGDWSFIDCEMEEVDLQDLPSATIACHLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQLHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQEKEEEEEMERMRRPKPKIIQTRRPEYTPIHLS