Protein Classes
Protein Summary
Inhibits calcineurin-dependent transcriptional responses by binding to the catalytic domain of calcineurin A (PubMed:12809556). Could play a role during central nervous system development (By similarity). The protein encoded by this gene interacts with calcineurin A and inhibits calcineurin-dependent signaling pathways, possibly affecting central nervous system development. This gene is located in the minimal candidate region for the Down syndrome phenotype, and is overexpressed in the brain of Down syndrome fetuses. Chronic overexpression of this gene may lead to neurofibrillary tangles such as those associated with Alzheimer disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2013]
- ENST00000313806
- ENSP00000320768
- ENSG00000159200
- ENST00000381132
- ENSP00000370524
- ENST00000399272
- ENSP00000382214
- ENST00000443408
- ENSP00000392438
- ENST00000482533
- ENSP00000419624
- ENST00000487990
- ENSP00000419252
- ENST00000620920
- ENSP00000477646
- ADAPT78
- CSP1
- DSC1
- DSCR1
- CSP1
- DSC1
- RCN1
- DSCR1
- MCIP1
- ADAPT78
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
---|---|---|---|
kinase | 0.9 | ||
transcription factor | 0.9 | ||
PubMedID | 0.89 | ||
transcription factor perturbation | 0.88 | ||
disease perturbation | 0.87 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 280.33 (req: < 5)
Gene RIFs: 86 (req: <= 3)
Antibodies: 521 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 280.33 (req: >= 5)
Gene RIFs: 86 (req: > 3)
Antibodies: 521 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 10
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligand: 0
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 0
Pathways (44)
KEGG (3)
PathwayCommons (3)
WikiPathways (38)
Items per page:
1 – 3 of 3
Data Source | Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|---|
KEGG | Oxytocin signaling pathway | ||||
KEGG | Kaposi sarcoma-associated herpesvirus infection | ||||
KEGG | Thyroid hormone signaling pathway | ||||
Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|
Oxytocin signaling pathway | ||||
Kaposi sarcoma-associated herpesvirus infection | ||||
Thyroid hormone signaling pathway | ||||
Gene Ontology Terms (12)
Functions (4)
Components (2)
Processes (6)
Items per page:
10
1 – 4 of 4
GO Term | Evidence | Assigned by | ||
---|---|---|---|---|
Inferred from Physical Interaction (IPI) | IntAct | |||
Inferred from Biological aspect of Ancestor (IBA) | GO_Central | |||
Traceable Author Statement (TAS) | ProtInc | |||
Traceable Author Statement (TAS) | ProtInc | |||
Protein-Protein Interactions (83)
1 – 10 of 83
PPP3CA
Family: Enzyme
Novelty: 0.00238194
p_int: 1
Score: 0.954
Data Source: BioPlex,STRINGDB
PPP3CC
Family: Enzyme
Novelty: 0.04180044
p_int: 1
Score: 0.827
Data Source: BioPlex,STRINGDB
PPP3R2
Novelty: 0.0210854
p_int: 0.999999919
p_ni: 4.9e-8
p_wrong: 3.1e-8
Score: 0.368
Data Source: BioPlex,STRINGDB
GSK3A
Family: Kinase
Novelty: 0.01538406
p_int: 0.99999773
p_ni: 7.7e-7
p_wrong: 0.000001501
Score: 0.715
Data Source: BioPlex,STRINGDB
PPP3CB
Family: Enzyme
Novelty: 0.02520885
p_int: 0.999982418
p_ni: 0.000017582
Score: 0.846
Data Source: BioPlex,STRINGDB
PPP3R1
Novelty: 0.00213192
p_int: 0.99997993
p_ni: 0.000020069
Score: 0.885
Data Source: BioPlex,STRINGDB
ARMT1
Family: Enzyme
Novelty: 0.28301887
p_int: 0.999956051
p_ni: 0.000043949
Score: 0.269
Data Source: BioPlex,STRINGDB
SRBD1
Novelty: 0.34233385
p_int: 0.999946791
p_ni: 0.000053205
p_wrong: 4e-9
Score: 0.694
Data Source: BioPlex,STRINGDB
FAM122A
Novelty: 0.76767677
p_int: 0.999875073
p_ni: 0.000014226
p_wrong: 0.000110701
Score: 0.85
Data Source: BioPlex,STRINGDB
CST2
Novelty: 0.03317401
p_int: 0.99884303
p_ni: 0.00079259
p_wrong: 0.00036438
Score: 0.186
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score 280.33
PubMed score by year
PubTator Score 191.98
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEDGVAGPQLGAAAEAAEAAEARARPGVTLRPFAPLSGAAEADEGGGDWSFIDCEMEEVDLQDLPSATIA
1-70
CHLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQLHKTEFLGKEMKLYF
70-140
AQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPS
140-210
VVVHVCESDQEKEEEEEMERMRRPKPKIIQTRRPEYTPIHLS
210-252
MEDGVAGPQLGAAAEAAEAAEARARPGVTLRPFAPLSGAAEADEGGGDWSFIDCEMEEVDLQDLPSATIACHLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQLHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQEKEEEEEMERMRRPKPKIIQTRRPEYTPIHLS
Find similar targets by: