You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
FOSB
Protein fosB

Protein Summary
Description
FosB interacts with Jun proteins enhancing their DNA binding activity. The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000353609
  • ENSP00000245919
  • ENSG00000125740
  • ENST00000417353
  • ENSP00000407207
  • ENST00000443841
  • ENSP00000414177
  • ENST00000585836
  • ENSP00000467497
  • ENST00000586615
  • ENSP00000468207
  • ENST00000591858
  • ENSP00000466530
  • ENST00000615753
  • ENSP00000485018

Symbol
  • G0S3
  • AP-1
  • G0S3
  • GOS3
  • GOSB
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.98
transcription factor
0.87
transcription factor binding site profile
0.87
small molecule perturbation
0.79
biological process
0.78


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 471.04   (req: < 5)
Gene RIFs: 37   (req: <= 3)
Antibodies: 472   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 471.04   (req: >= 5)
Gene RIFs: 37   (req: > 3)
Antibodies: 472   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 15
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (6)
1 – 5 of 6
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (22)
ESR-mediated signaling (R-HSA-8939211)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
ESR-mediated signaling
Reactome
Estrogen-dependent gene expression
Reactome
Signal Transduction
Reactome
Signaling by Nuclear Receptors
Name
Explore in Pharos
Explore in Source
ESR-mediated signaling
Estrogen-dependent gene expression
Signal Transduction
Signaling by Nuclear Receptors
Gene Ontology Terms (18)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence Alignment (ISA)
NTNU_SB
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (117)
1 – 10 of 117
JUNB
Tbio
Family: TF
Novelty: 0.01119828
p_int: 0.999998424
p_wrong: 0.000001576
Score: 0.992
Data Source: BioPlex,STRINGDB
JUN
Tchem
Family: TF
Novelty: 0.00013623
Score: 0.997
Data Source: STRINGDB
JUND
Tbio
Family: TF
Novelty: 0.00337776
Score: 0.995
Data Source: Reactome,STRINGDB
FOS
Tbio
Family: TF
Novelty: 0.00007002
Score: 0.983
Data Source: STRINGDB
CDK5
Tchem
Family: Kinase
Novelty: 0.00081843
Score: 0.953
Data Source: STRINGDB
EP300
Tchem
Family: Epigenetic
Novelty: 0.00060382
Score: 0.946
Data Source: STRINGDB
MAFG
Tbio
Family: TF
Novelty: 0.01506352
Score: 0.941
Data Source: STRINGDB
EGR1
Tbio
Family: TF
Novelty: 0.0004835
Score: 0.94
Data Source: STRINGDB
MYC
Tbio
Family: TF
Novelty: 0.000073
Score: 0.937
Data Source: STRINGDB
HIST1H2BA
Tbio
Novelty: 0.03503778
Score: 0.934
Data Source: STRINGDB
Publication Statistics
PubMed Score  471.04

PubMed score by year
PubTator Score  359.43

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTAITTSQDLQWL
1-70
VQPTLISSMAQSQGQPLASQPPVVDPYDMPGTSYSTPGMSGYSSGGASGSGGPSTSGTTSGPGPARPARA
70-140
RPRRPREETLTPEEEEKRRVRRERNKLAAAKCRNRRRELTDRLQAETDQLEEEKAELESEIAELQKEKER
140-210
LEFVLVAHKPGCKIPYEEGPGPGPLAEVRDLPGSAPAKEDGFSWLLPPPPPPPLPFQTSQDAPPNLTASL
210-280
FTHSEVQVLGDPFPVVNPSYTSSFVLTCPEVSAFAGAQRTSGSDQPSDPLNSPSLLAL
280-338
MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTAITTSQDLQWLVQPTLISSMAQSQGQPLASQPPVVDPYDMPGTSYSTPGMSGYSSGGASGSGGPSTSGTTSGPGPARPARARPRRPREETLTPEEEEKRRVRRERNKLAAAKCRNRRRELTDRLQAETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEGPGPGPLAEVRDLPGSAPAKEDGFSWLLPPPPPPPLPFQTSQDAPPNLTASLFTHSEVQVLGDPFPVVNPSYTSSFVLTCPEVSAFAGAQRTSGSDQPSDPLNSPSLLAL