You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PPP5C
Serine/threonine-protein phosphatase 5

Protein Summary
Description
Serine/threonine-protein phosphatase that dephosphorylates a myriad of proteins involved in different signaling pathways including the kinases CSNK1E, ASK1/MAP3K5, PRKDC and RAF1, the nuclear receptors NR3C1, PPARG, ESR1 and ESR2, SMAD proteins and TAU/MAPT. Implicated in wide ranging cellular processes, including apoptosis, differentiation, DNA damage response, cell survival, regulation of ion channels or circadian rhythms, in response to steroid and thyroid hormones, calcium, fatty acids, TGF-beta as well as oxidative and genotoxic stresses. Participates in the control of DNA damage response mechanisms such as checkpoint activation and DNA damage repair through, for instance, the regulation ATM/ATR-signaling and dephosphorylation of PRKDC and TP53BP1. Inhibits ASK1/MAP3K5-mediated apoptosis induced by oxidative stress. Plays a positive role in adipogenesis, mainly through the dephosphorylation and activation of PPARG transactivation function. Also dephosphorylates and inhibits the an ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000012443
  • ENSP00000012443
  • ENSG00000011485

Symbol
  • PPP5
  • PP5
  • PPT
  • PPP5
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.99
interacting protein
0.92
transcription factor perturbation
0.88
transcription factor binding site profile
0.75
molecular function
0.73


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 46.47   (req: < 5)
Gene RIFs: 35   (req: <= 3)
Antibodies: 558   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 46.47   (req: >= 5)
Gene RIFs: 35   (req: > 3)
Antibodies: 558   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 30
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (18)
1 – 5 of 18
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (34)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 16
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
DNA Double Strand Break Response
Reactome
DNA Double-Strand Break Repair
Reactome
DNA Repair
Reactome
ESR-mediated signaling
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
DNA Double Strand Break Response
DNA Double-Strand Break Repair
DNA Repair
ESR-mediated signaling
Gene Ontology Terms (39)
Items per page:
10
1 – 10 of 12
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
MGI
Inferred from Direct Assay (IDA)
MGI
Inferred from Direct Assay (IDA)
ARUK-UCL
Inferred from Physical Interaction (IPI)
CAFA
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
ARUK-UCL
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (155)
1 – 10 of 155
POLD2
Tbio
Family: Enzyme
Novelty: 0.08812112
p_int: 0.960531824
p_ni: 0.039468172
p_wrong: 4e-9
Score: 0.238
Data Source: BioPlex,STRINGDB
RAB41
Tdark
Family: Enzyme
p_int: 0.950270687
p_ni: 0.049729313
Score: 0.633
Data Source: BioPlex,STRINGDB
BPHL
Tbio
Family: Enzyme
Novelty: 0.04227372
p_int: 0.911727909
p_ni: 0.088272091
Score: 0.472
Data Source: BioPlex,STRINGDB
GADL1
Tbio
Family: Enzyme
Novelty: 0.02413959
p_int: 0.850368967
p_ni: 0.149631033
Data Source: BioPlex
HSP90AA1
Tchem
Novelty: 0.00020424
Score: 0.988
Data Source: STRINGDB
CDC37
Tbio
Novelty: 0.0735786
Score: 0.977
Data Source: STRINGDB
HSP90AB1
Tchem
Novelty: 0.01466977
Score: 0.976
Data Source: STRINGDB
PTGES3
Tbio
Family: Enzyme
Novelty: 0.01060343
Score: 0.976
Data Source: STRINGDB
PPID
Tchem
Family: Enzyme
Novelty: 0.01487032
Score: 0.948
Data Source: STRINGDB
STIP1
Tbio
Novelty: 0.00853676
Score: 0.945
Data Source: STRINGDB
Publication Statistics
PubMed Score  46.47

PubMed score by year
PubTator Score  120.01

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAMAEGERTECAEPPRDEPPADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSL
1-70
AYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECN
70-140
KIVKQKAFERAIAGDEHKRSVVDSLDIESMTIEDEYSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAY
140-210
QILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSV
210-280
EVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLI
280-350
MHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNL
350-420
DYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYA
420-490
NTLLQLGMM
490-499
MAMAEGERTECAEPPRDEPPADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAGDEHKRSVVDSLDIESMTIEDEYSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYANTLLQLGMM