You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
HNRNPA3
Heterogeneous nuclear ribonucleoprotein A3

Protein Summary
Description
Plays a role in cytoplasmic trafficking of RNA. Binds to the cis-acting response element, A2RE. May be involved in pre-mRNA splicing.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000392524
  • ENSP00000376309
  • ENSG00000170144
  • ENST00000411529
  • ENSP00000408487
  • ENST00000435711
  • ENSP00000416340

Symbol
  • HNRPA3
  • FBRNP
  • HNRPA3
  • D10S102
  • 2610510D13Rik
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
interacting protein
1
transcription factor perturbation
1
co-expressed gene
0.99
microRNA
0.88
virus perturbation
0.76


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 20.7   (req: < 5)
Gene RIFs: 8   (req: <= 3)
Antibodies: 122   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 20.7   (req: >= 5)
Gene RIFs: 8   (req: > 3)
Antibodies: 122   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (5)
Metabolism of RNA (R-HSA-8953854)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism of RNA
Reactome
Processing of Capped Intron-Containing Pre-mRNA
Reactome
mRNA Splicing
Reactome
mRNA Splicing - Major Pathway
Name
Explore in Pharos
Explore in Source
Metabolism of RNA
Processing of Capped Intron-Containing Pre-mRNA
mRNA Splicing
mRNA Splicing - Major Pathway
Gene Ontology Terms (15)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (307)
1 – 10 of 307
HNRNPH1
Tbio
Novelty: 0.01807307
Score: 0.996
Data Source: STRINGDB
HNRNPL
Tbio
Novelty: 0.00274698
Score: 0.996
Data Source: STRINGDB
PTBP1
Tbio
Novelty: 0.00204645
Score: 0.995
Data Source: STRINGDB
HNRNPA2B1
Tbio
Novelty: 0.00503583
Score: 0.993
Data Source: STRINGDB
SRSF1
Tbio
Novelty: 0.00119334
Score: 0.991
Data Source: STRINGDB
HNRNPF
Tbio
Novelty: 0.02623395
Score: 0.989
Data Source: STRINGDB
TRA2B
Tbio
Novelty: 0.02179789
Score: 0.989
Data Source: STRINGDB
HNRNPK
Tbio
Novelty: 0.00343899
Score: 0.989
Data Source: STRINGDB
HNRNPC
Tbio
Novelty: 0.00195495
Score: 0.986
Data Source: STRINGDB
HNRNPM
Tbio
Novelty: 0.01865149
Score: 0.986
Data Source: STRINGDB
Publication Statistics
PubMed Score  20.70

PubMed score by year
PubTator Score  9.71

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDP
1-70
QTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVEPKRAVSREDSVKPGAHLTVKKIFVGGIKEDTEEY
70-140
NLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEVKKALSKQEMQSA
140-210
GSQRGRGGGSGNFMGRGGNFGGGGGNFGRGGNFGGRGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGG
210-280
PGYSSRGGYGGGGPGYGNQGGGYGGGGGYDGYNEGGNFGGGNYGGGGNYNDFGNYSGQQQSNYGPMKGGS
280-350
FGGRSSGSPYGGGYGSGGGSGGYGSRRF
350-378
MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVEPKRAVSREDSVKPGAHLTVKKIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEVKKALSKQEMQSAGSQRGRGGGSGNFMGRGGNFGGGGGNFGRGGNFGGRGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGGPGYSSRGGYGGGGPGYGNQGGGYGGGGGYDGYNEGGNFGGGNYGGGGNYNDFGNYSGQQQSNYGPMKGGSFGGRSSGSPYGGGYGSGGGSGGYGSRRF