You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
UBE2E1
Ubiquitin-conjugating enzyme E2 E1

Protein Summary
Description
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Catalyzes the covalent attachment of ISG15 to other proteins. Mediates the selective degradation of short-lived and abnormal proteins. In vitro also catalyzes 'Lys-48'-linked polyubiquitination. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jan 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000306627
  • ENSP00000303709
  • ENSG00000170142
  • ENST00000346855
  • ENSP00000329113
  • ENST00000424381
  • ENSP00000411351

Symbol
  • UBCH6
  • UBCH6
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.96
molecular function
0.93
disease perturbation
0.87
transcription factor
0.77
transcription factor binding site profile
0.72


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 12.96   (req: < 5)
Gene RIFs: 12   (req: <= 3)
Antibodies: 101   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 12.96   (req: >= 5)
Gene RIFs: 12   (req: > 3)
Antibodies: 101   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (50)
APC-Cdc20 mediated degradation of Nek2A (R-HSA-179409)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 46
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
APC-Cdc20 mediated degradation of Nek2A
Reactome
APC/C-mediated degradation of cell cycle proteins
Reactome
APC/C:Cdc20 mediated degradation of Cyclin B
Reactome
APC/C:Cdc20 mediated degradation of Securin
Reactome
APC/C:Cdc20 mediated degradation of mitotic proteins
Name
Explore in Pharos
Explore in Source
APC-Cdc20 mediated degradation of Nek2A
APC/C-mediated degradation of cell cycle proteins
APC/C:Cdc20 mediated degradation of Cyclin B
APC/C:Cdc20 mediated degradation of Securin
APC/C:Cdc20 mediated degradation of mitotic proteins
Protein-Protein Interactions (444)
1 – 10 of 444
RNF25
Tbio
Family: Enzyme
Novelty: 0.00264841
p_int: 0.999868673
p_ni: 0.000122447
p_wrong: 0.000008879
Score: 0.95
Data Source: BioPlex,STRINGDB
DET1
Tbio
Novelty: 0.01807423
p_int: 0.992116133
p_ni: 0.007883835
p_wrong: 3.1e-8
Score: 0.985
Data Source: BioPlex,STRINGDB
SIK1
Tchem
Family: Kinase
Novelty: 0.00660123
p_int: 0.910832624
p_ni: 0.089043407
p_wrong: 0.00012397
Score: 0.197
Data Source: BioPlex,STRINGDB
TRIB1
Tbio
Family: Kinase
Novelty: 0.01783401
p_int: 0.909383861
p_ni: 0.090556475
p_wrong: 0.000059664
Score: 0.838
Data Source: BioPlex,STRINGDB
TRIB2
Tbio
Family: Kinase
Novelty: 0.02702835
p_int: 0.899033578
p_ni: 0.100861221
p_wrong: 0.0001052
Score: 0.83
Data Source: BioPlex,STRINGDB
MBD5
Tbio
Family: Epigenetic
Novelty: 0.03239638
p_int: 0.868623046
p_ni: 0.131326151
p_wrong: 0.000050804
Score: 0.539
Data Source: BioPlex,STRINGDB
ID2
Tbio
Family: TF
Novelty: 0.00329378
p_int: 0.836669432
p_ni: 0.163206646
p_wrong: 0.000123922
Score: 0.177
Data Source: BioPlex,STRINGDB
STUB1
Tbio
Family: Enzyme
Novelty: 0.00091876
Score: 0.982
Data Source: STRINGDB
UBA1
Tbio
Novelty: 0.00582285
Score: 0.98
Data Source: STRINGDB
UBA7
Tbio
Novelty: 0.02293227
Score: 0.98
Data Source: STRINGDB
Publication Statistics
PubMed Score  12.96

PubMed score by year
PubTator Score  23.14

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSDDDSRASTSSSSSSSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAKRIQKELADITLDPPPNCSAG
1-70
PKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWS
70-140
PALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT
140-193
MSDDDSRASTSSSSSSSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAKRIQKELADITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT