You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
NR0B1
Nuclear receptor subfamily 0 group B member 1

Protein Summary
Description
Orphan nuclear receptor. Component of a cascade required for the development of the hypothalamic-pituitary-adrenal-gonadal axis. Acts as a coregulatory protein that inhibits the transcriptional activity of other nuclear receptors through heterodimeric interactions. May also have a role in the development of the embryo and in the maintenance of embryonic stem cell pluripotency (By similarity). This gene encodes a protein that contains a DNA-binding domain. The encoded protein acts as a dominant-negative regulator of transcription which is mediated by the retinoic acid receptor. This protein also functions as an anti-testis gene by acting antagonistically to Sry. Mutations in this gene result in both X-linked congenital adrenal hypoplasia and hypogonadotropic hypogonadism. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000378970
  • ENSP00000368253
  • ENSG00000169297

Symbol
  • AHC
  • DAX1
  • AHC
  • AHX
  • DSS
  • GTD
  • HHG
  • AHCH
  • DAX1
  • DAX-1
  • NROB1
  • SRXY2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.97
biological process
0.84
biological term
0.78
gene perturbation
0.77
PubMedID
0.74


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 594.76   (req: < 5)
Gene RIFs: 91   (req: <= 3)
Antibodies: 599   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 594.76   (req: >= 5)
Gene RIFs: 91   (req: > 3)
Antibodies: 599   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 31
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (14)
Gene expression (Transcription) (R-HSA-74160)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Reactome
Nuclear Receptor transcription pathway
Reactome
RNA Polymerase II Transcription
Name
Explore in Pharos
Explore in Source
Gene expression (Transcription)
Generic Transcription Pathway
Nuclear Receptor transcription pathway
RNA Polymerase II Transcription
Gene Ontology Terms (39)
Items per page:
10
1 – 10 of 13
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
HGNC
Inferred from Direct Assay (IDA)
HGNC
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
HGNC
Inferred from Direct Assay (IDA)
HGNC
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
BHF-UCL
Protein-Protein Interactions (147)
1 – 10 of 147
NR5A1
Tchem
Family: NR
Novelty: 0.00114781
Score: 0.983
Data Source: STRINGDB
AR
Tclin
Family: NR
Novelty: 0.00013834
Score: 0.968
Data Source: STRINGDB
ESR1
Tclin
Family: NR
Novelty: 0.00008166
Score: 0.963
Data Source: STRINGDB
ESR2
Tclin
Family: NR
Novelty: 0.00025767
Score: 0.954
Data Source: STRINGDB
NR5A2
Tchem
Family: NR
Novelty: 0.00307622
Score: 0.913
Data Source: STRINGDB
POU5F1
Tbio
Family: TF
Novelty: 0.000425
Score: 0.87
Data Source: STRINGDB
NANOG
Tbio
Family: TF
Novelty: 0.00073323
Score: 0.838
Data Source: STRINGDB
WT1
Tbio
Family: TF
Novelty: 0.00042049
Score: 0.838
Data Source: STRINGDB
STAR
Tbio
Novelty: 0.00143063
Score: 0.809
Data Source: STRINGDB
AMH
Tbio
Novelty: 0.0003157
Score: 0.79
Data Source: STRINGDB
Publication Statistics
PubMed Score  594.76

PubMed score by year
PubTator Score  343.36

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MAGENHQWQGSILYNMLMSAKQTRAAPEAPETRLVDQCWGCSCGDEPGVGREGLLGGRNVALLYRCCFCG
1-70
KDHPRQGSILYSMLTSAKQTYAAPKAPEATLGPCWGCSCGSDPGVGRAGLPGGRPVALLYRCCFCGEDHP
70-140
RQGSILYSLLTSSKQTHVAPAAPEARPGGAWWDRSYFAQRPGGKEALPGGRATALLYRCCFCGEDHPQQG
140-210
STLYCVPTSTNQAQAAPEERPRAPWWDTSSGALRPVALKSPQVVCEAASAGLLKTLRFVKYLPCFQVLPL
210-280
DQQLVLVRNCWASLLMLELAQDRLQFETVEVSEPSMLQKILTTRRRETGGNEPLPVPTLQHHLAPPAEAR
280-350
KVPSASQVQAIKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYIQGLQWGTQQILSEHTRMTHQ
350-420
GPHDRFIELNSTLFLLRFINANVIAELFFRPIIGTVSMDDMMLEMLCTKI
420-470
MAGENHQWQGSILYNMLMSAKQTRAAPEAPETRLVDQCWGCSCGDEPGVGREGLLGGRNVALLYRCCFCGKDHPRQGSILYSMLTSAKQTYAAPKAPEATLGPCWGCSCGSDPGVGRAGLPGGRPVALLYRCCFCGEDHPRQGSILYSLLTSSKQTHVAPAAPEARPGGAWWDRSYFAQRPGGKEALPGGRATALLYRCCFCGEDHPQQGSTLYCVPTSTNQAQAAPEERPRAPWWDTSSGALRPVALKSPQVVCEAASAGLLKTLRFVKYLPCFQVLPLDQQLVLVRNCWASLLMLELAQDRLQFETVEVSEPSMLQKILTTRRRETGGNEPLPVPTLQHHLAPPAEARKVPSASQVQAIKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYIQGLQWGTQQILSEHTRMTHQGPHDRFIELNSTLFLLRFINANVIAELFFRPIIGTVSMDDMMLEMLCTKI