You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
RPS6KA3
Ribosomal protein S6 kinase alpha-3

Protein Summary
Description
Serine/threonine-protein kinase that acts downstream of ERK (MAPK1/ERK2 and MAPK3/ERK1) signaling and mediates mitogenic and stress-induced activation of the transcription factors CREB1, ETV1/ER81 and NR4A1/NUR77, regulates translation through RPS6 and EIF4B phosphorylation, and mediates cellular proliferation, survival, and differentiation by modulating mTOR signaling and repressing pro-apoptotic function of BAD and DAPK1. In fibroblast, is required for EGF-stimulated phosphorylation of CREB1 and histone H3 at 'Ser-10', which results in the subsequent transcriptional activation of several immediate-early genes. In response to mitogenic stimulation (EGF and PMA), phosphorylates and activates NR4A1/NUR77 and ETV1/ER81 transcription factors and the cofactor CREBBP. Upon insulin-derived signal, acts indirectly on the transcription regulation of several genes by phosphorylating GSK3B at 'Ser-9' and inhibiting its activity. Phosphorylates RPS6 in response to serum or EGF via an mTOR-indepen ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000379565
  • ENSP00000368884
  • ENSG00000177189
  • ENST00000645845
  • ENSP00000494131

Symbol
  • ISPK1
  • MAPKAPK1B
  • RSK2
  • CLS
  • RSK
  • HU-3
  • RSK2
  • MRX19
  • ISPK-1
  • p90-RSK2
  • pp90RSK2
  • MAPKAPK1B
  • S6K-alpha3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
hub protein
1
molecular function
1
interacting protein
0.99
kinase
0.99
protein domain
0.97


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 345.43   (req: < 5)
Gene RIFs: 76   (req: <= 3)
Antibodies: 544   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 345.43   (req: >= 5)
Gene RIFs: 76   (req: > 3)
Antibodies: 544   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 23
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 102
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (102)
1 – 10 of 102
CHEMBL509032
chemical structure image
CHEMBL495727
chemical structure image
CHEMBL2086760
chemical structure image
CHEMBL2064666
chemical structure image
CHEMBL2347053
chemical structure image
CHEMBL1933288
chemical structure image
CHEMBL515414
chemical structure image
CHEMBL3673623
chemical structure image
BI-D1870
chemical structure image
Protein Data Bank (10)
1 – 5 of 10
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (91)
Activation of NMDA receptors and postsynaptic events (R-HSA-442755)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 49
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activation of NMDA receptors and postsynaptic events
Reactome
Axon guidance
Reactome
CREB phosphorylation
Reactome
CREB1 phosphorylation through NMDA receptor-mediated activation of RAS signaling
Reactome
Cellular Senescence
Name
Explore in Pharos
Explore in Source
Activation of NMDA receptors and postsynaptic events
Axon guidance
CREB phosphorylation
CREB1 phosphorylation through NMDA receptor-mediated activation of RAS signaling
Cellular Senescence
Gene Ontology Terms (25)
Items per page:
10
1 – 8 of 8
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
InterPro
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (156)
1 – 10 of 156
MISP
Tbio
Novelty: 0.01696113
p_int: 0.999998918
p_ni: 0.00000108
p_wrong: 2e-9
Data Source: BioPlex
CSNK2B
Tbio
Family: Kinase
Novelty: 0.00171173
p_int: 0.99999419
p_ni: 0.00000581
Score: 0.466
Data Source: BioPlex,STRINGDB
FGFR2
Tclin
Family: Kinase
Novelty: 0.00077461
p_int: 0.999984207
p_ni: 0.000015792
Score: 0.239
Data Source: BioPlex,STRINGDB
FYN
Tclin
Family: Kinase
Novelty: 0.00092113
p_int: 0.999979116
p_ni: 0.000020884
Score: 0.371
Data Source: BioPlex,STRINGDB
TRIM11
Tbio
Family: Enzyme
Novelty: 0.02738803
p_int: 0.999953011
p_ni: 0.000046989
Data Source: BioPlex
IL17RA
Tclin
Novelty: 0.00599602
p_int: 0.999871635
p_ni: 0.000128365
Score: 0.298
Data Source: BioPlex,STRINGDB
WDYHV1
Tdark
Family: Enzyme
Novelty: 0.23412216
p_int: 0.999871024
p_ni: 0.000128975
Data Source: BioPlex
TMEM139
Tdark
Novelty: 3
p_int: 0.992712911
p_ni: 0.00728708
p_wrong: 9e-9
Score: 0.455
Data Source: BioPlex,STRINGDB
ZMYM5
Tdark
Novelty: 0.09559462
p_int: 0.990561618
p_ni: 0.009438382
Score: 0.516
Data Source: BioPlex,STRINGDB
SLC9A3R2
Tbio
Family: Transporter
Novelty: 0.01296563
p_int: 0.987890172
p_ni: 0.012109828
Data Source: BioPlex
Publication Statistics
PubMed Score  345.43

PubMed score by year
PubTator Score  186.53

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MPLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEVSIKEIAITHHVKEGHEKADPSQFEL
1-70
LKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKATLKVRDRVRTKMERDILVEVNHPFIVKLHYAFQTE
70-140
GKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDEEGHIKLT
140-210
DFGLSKESIDHEKKAYSFCGTVEYMAPEVVNRRGHTQSADWWSFGVLMFEMLTGTLPFQGKDRKETMTMI
210-280
LKAKLGMPQFLSPEAQSLLRMLFKRNPANRLGAGPDGVEEIKRHSFFSTIDWNKLYRREIHPPFKPATGR
280-350
PEDTFYFDPEFTAKTPKDSPGIPPSANAHQLFRGFSFVAITSDDESQAMQTVGVHSIVQQLHRNSIQFTD
350-420
GYEVKEDIGVGSYSVCKRCIHKATNMEFAVKIIDKSKRDPTEEIEILLRYGQHPNIITLKDVYDDGKYVY
420-490
VVTELMKGGELLDKILRQKFFSEREASAVLFTITKTVEYLHAQGVVHRDLKPSNILYVDESGNPESIRIC
490-560
DFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDAACDIWSLGVLLYTMLTGYTPFANGPDDTPEEIL
560-630
ARIGSGKFSLSGGYWNSVSDTAKDLVSKMLHVDPHQRLTAALVLRHPWIVHWDQLPQYQLNRQDAPHLVK
630-700
GAMAATYSALNRNQSPVLEPVGRSTLAQRRGIKKITSTAL
700-740
MPLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEVSIKEIAITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKATLKVRDRVRTKMERDILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKESIDHEKKAYSFCGTVEYMAPEVVNRRGHTQSADWWSFGVLMFEMLTGTLPFQGKDRKETMTMILKAKLGMPQFLSPEAQSLLRMLFKRNPANRLGAGPDGVEEIKRHSFFSTIDWNKLYRREIHPPFKPATGRPEDTFYFDPEFTAKTPKDSPGIPPSANAHQLFRGFSFVAITSDDESQAMQTVGVHSIVQQLHRNSIQFTDGYEVKEDIGVGSYSVCKRCIHKATNMEFAVKIIDKSKRDPTEEIEILLRYGQHPNIITLKDVYDDGKYVYVVTELMKGGELLDKILRQKFFSEREASAVLFTITKTVEYLHAQGVVHRDLKPSNILYVDESGNPESIRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDAACDIWSLGVLLYTMLTGYTPFANGPDDTPEEILARIGSGKFSLSGGYWNSVSDTAKDLVSKMLHVDPHQRLTAALVLRHPWIVHWDQLPQYQLNRQDAPHLVKGAMAATYSALNRNQSPVLEPVGRSTLAQRRGIKKITSTAL