You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
VAMP7
Vesicle-associated membrane protein 7

Protein Summary
Description
Involved in the targeting and/or fusion of transport vesicles to their target membrane during transport of proteins from the early endosome to the lysosome. Required for heterotypic fusion of late endosomes with lysosomes and homotypic lysosomal fusion. Required for calcium regulated lysosomal exocytosis. Involved in the export of chylomicrons from the endoplasmic reticulum to the cis Golgi. Required for exocytosis of mediators during eosinophil and neutrophil degranulation, and target cell killing by natural killer cells. Required for focal exocytosis of late endocytic vesicles during phagosome formation. This gene encodes a transmembrane protein that is a member of the soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE) family. The encoded protein localizes to late endosomes and lysosomes and is involved in the fusion of transport vesicles to their target membranes. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Jun 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000262640
  • ENSP00000262640
  • ENSG00000124333
  • ENST00000286448
  • ENSP00000286448
  • ENST00000460621
  • ENSP00000427822

Symbol
  • SYBL1
  • SYBL1
  • TIVAMP
  • VAMP-7
  • TI-VAMP
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.95
histone modification site profile
0.88
cellular component
0.86
transcription factor perturbation
0.84
interacting protein
0.74


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 91.32   (req: < 5)
Gene RIFs: 35   (req: <= 3)
Antibodies: 202   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 91.32   (req: >= 5)
Gene RIFs: 35   (req: > 3)
Antibodies: 202   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 22
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (13)
Cargo recognition for clathrin-mediated endocytosis (R-HSA-8856825)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 12
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cargo recognition for clathrin-mediated endocytosis
Reactome
Clathrin-mediated endocytosis
Reactome
Cytokine Signaling in Immune system
Reactome
Golgi Associated Vesicle Biogenesis
Reactome
Immune System
Name
Explore in Pharos
Explore in Source
Cargo recognition for clathrin-mediated endocytosis
Clathrin-mediated endocytosis
Cytokine Signaling in Immune system
Golgi Associated Vesicle Biogenesis
Immune System
Gene Ontology Terms (48)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (300)
1 – 10 of 300
STX12
Tbio
Novelty: 0.07003045
p_int: 0.989579802
p_ni: 0.010420198
Score: 0.987
Data Source: BioPlex,STRINGDB
SNAP29
Tbio
Novelty: 0.02549569
p_int: 0.9534844
p_ni: 0.0465156
Score: 0.996
Data Source: BioPlex,STRINGDB
SIRT2
Tchem
Family: Epigenetic
Novelty: 0.00117896
p_int: 0.890779918
p_ni: 0.109220082
Score: 0.189
Data Source: BioPlex,STRINGDB
STX7
Tbio
Novelty: 0.052457
p_int: 0.841014952
p_ni: 0.158985048
Score: 0.985
Data Source: BioPlex,STRINGDB
GINM1
Tdark
p_int: 0.837152411
p_ni: 0.162847589
Data Source: BioPlex
SNAP23
Tbio
Novelty: 0.00732279
Score: 0.995
Data Source: Reactome,STRINGDB
STX6
Tbio
Novelty: 0.01577464
Score: 0.99
Data Source: STRINGDB
STX4
Tbio
Novelty: 0.01072491
Score: 0.988
Data Source: Reactome,STRINGDB
SNAP25
Tclin
Novelty: 0.0020914
Score: 0.987
Data Source: STRINGDB
VAMP8
Tbio
Novelty: 0.01382646
Score: 0.984
Data Source: STRINGDB
Publication Statistics
PubMed Score  91.32

PubMed score by year
PubTator Score  63.12

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDF
1-70
ERSRAFNFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENKGLDKVMETQAQVDELKGIM
70-140
VRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMCMKNLKLTIIIIIVSIVFIYIIVSPLCG
140-210
GFTWPSCVKK
210-220
MAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFNFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENKGLDKVMETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMCMKNLKLTIIIIIVSIVFIYIIVSPLCGGFTWPSCVKK