You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
IRAK1
Interleukin-1 receptor-associated kinase 1

Protein Summary
Description
Serine/threonine-protein kinase that plays a critical role in initiating innate immune response against foreign pathogens. Involved in Toll-like receptor (TLR) and IL-1R signaling pathways. Is rapidly recruited by MYD88 to the receptor-signaling complex upon TLR activation. Association with MYD88 leads to IRAK1 phosphorylation by IRAK4 and subsequent autophosphorylation and kinase activation. Phosphorylates E3 ubiquitin ligases Pellino proteins (PELI1, PELI2 and PELI3) to promote pellino-mediated polyubiquitination of IRAK1. Then, the ubiquitin-binding domain of IKBKG/NEMO binds to polyubiquitinated IRAK1 bringing together the IRAK1-MAP3K7/TAK1-TRAF6 complex and the NEMO-IKKA-IKKB complex. In turn, MAP3K7/TAK1 activates IKKs (CHUK/IKKA and IKBKB/IKKB) leading to NF-kappa-B nuclear translocation and activation. Alternatively, phosphorylates TIRAP to promote its ubiquitination and subsequent degradation. Phosphorylates the interferon regulatory factor 7 (IRF7) to induce its activation an ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000369974
  • ENSP00000358991
  • ENSG00000184216
  • ENST00000369980
  • ENSP00000358997
  • ENST00000393687
  • ENSP00000377291

Symbol
  • IRAK
  • IRAK
  • pelle
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
1
biological process
0.99
hub protein
0.98
transcription factor perturbation
0.94
small molecule
0.92


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 394.52   (req: < 5)
Gene RIFs: 133   (req: <= 3)
Antibodies: 954   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 394.52   (req: >= 5)
Gene RIFs: 133   (req: > 3)
Antibodies: 954   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 42
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 13
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
sunitinib
chemical structure image
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (97)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 46
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
Death Receptor Signalling
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Reactome
IRAK1 recruits IKK complex
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
Death Receptor Signalling
Gene expression (Transcription)
Generic Transcription Pathway
IRAK1 recruits IKK complex
Gene Ontology Terms (49)
Items per page:
10
1 – 8 of 8
GO Term
Evidence
Assigned by
Inferred from Experiment (EXP)
Reactome
Inferred from Direct Assay (IDA)
MGI
Inferred from Direct Assay (IDA)
MGI
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (223)
1 – 10 of 223
IL1R1
Tclin
Novelty: 0.00195105
Score: 0.999
Data Source: Reactome,STRINGDB
TRAF6
Tbio
Novelty: 0.00159491
Score: 0.999
Data Source: Reactome,STRINGDB
MYD88
Tbio
Novelty: 0.00054413
Score: 0.999
Data Source: Reactome,STRINGDB
TLR4
Tchem
Novelty: 0.00013074
Score: 0.994
Data Source: Reactome,STRINGDB
IKBKG
Tbio
Family: Kinase
Novelty: 0.00081998
Score: 0.994
Data Source: Reactome,STRINGDB
TAB2
Tbio
Family: Enzyme
Novelty: 0.01174781
Score: 0.992
Data Source: Reactome,STRINGDB
IRF7
Tbio
Family: TF
Novelty: 0.00308898
Score: 0.992
Data Source: Reactome,STRINGDB
TOLLIP
Tbio
Novelty: 0.01304711
Score: 0.992
Data Source: Reactome,STRINGDB
TLR2
Tchem
Novelty: 0.0002624
Score: 0.988
Data Source: Reactome,STRINGDB
TIRAP
Tbio
Novelty: 0.00571157
Score: 0.988
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  394.52

PubMed score by year
PubTator Score  282.37

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCERSGQRTASVL
1-70
WPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPLPSPGTTAPRPSSIPAPAEAEAWSPRKLPSSAS
70-140
TFLSPAFPGSQTHSGPELGLVPSPASLWPPPPSPAPSSTKPGPESSVSLLQGARPFPFCWPLCEISRGTH
140-210
NFSEELKIGEGGFGCVYRAVMRNTVYAVKRLKENADLEWTAVKQSFLTEVEQLSRFRHPNIVDFAGYCAQ
210-280
NGFYCLVYGFLPNGSLEDRLHCQTQACPPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDE
280-350
RLTPKLGDFGLARFSRFAGSSPSQSSMVARTQTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVVLETLAG
350-420
QRAVKTHGARTKYLKDLVEEEAEEAGVALRSTQSTLQAGLAADAWAAPIAMQIYKKHLDPRPGPCPPELG
420-490
LGLGQLACCCLHRRAKRRPPMTQVYERLEKLQAVVAGVPGHSEAASCIPPSPQENSYVSSTGRAHSGAAP
490-560
WQPLAAPSGASAQAAEQLQRGPNQPVESDESLGGLSAALRSWHLTPSCPLDPAPLREAGCPQGDTAGESS
560-630
WGSGPGSRPTAVEGLALGSSASSSSEPPQIIINPARQKMVQKLALYEDGALDSLQLLSSSSLPGLGLEQD
630-700
RQGPEESDEFQS
700-712
MAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCERSGQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPLPSPGTTAPRPSSIPAPAEAEAWSPRKLPSSASTFLSPAFPGSQTHSGPELGLVPSPASLWPPPPSPAPSSTKPGPESSVSLLQGARPFPFCWPLCEISRGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKRLKENADLEWTAVKQSFLTEVEQLSRFRHPNIVDFAGYCAQNGFYCLVYGFLPNGSLEDRLHCQTQACPPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDERLTPKLGDFGLARFSRFAGSSPSQSSMVARTQTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVVLETLAGQRAVKTHGARTKYLKDLVEEEAEEAGVALRSTQSTLQAGLAADAWAAPIAMQIYKKHLDPRPGPCPPELGLGLGQLACCCLHRRAKRRPPMTQVYERLEKLQAVVAGVPGHSEAASCIPPSPQENSYVSSTGRAHSGAAPWQPLAAPSGASAQAAEQLQRGPNQPVESDESLGGLSAALRSWHLTPSCPLDPAPLREAGCPQGDTAGESSWGSGPGSRPTAVEGLALGSSASSSSEPPQIIINPARQKMVQKLALYEDGALDSLQLLSSSSLPGLGLEQDRQGPEESDEFQS