You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
CYP2J2
Cytochrome P450 2J2

Protein Summary
Description
This enzyme metabolizes arachidonic acid predominantly via a NADPH-dependent olefin epoxidation to all four regioisomeric cis-epoxyeicosatrienoic acids. One of the predominant enzymes responsible for the epoxidation of endogenous cardiac arachidonic acid pools. This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is thought to be the predominant enzyme responsible for epoxidation of endogenous arachidonic acid in cardiac tissue. Multiple transcript variants have been found for this gene. [provided by RefSeq, Jan 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000371204
  • ENSP00000360247
  • ENSG00000134716

Symbol
  • CPJ2
  • CYPIIJ2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.88
molecular function
0.81
histone modification site profile
0.78
biological term
0.7
virus perturbation
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 173.99   (req: < 5)
Gene RIFs: 89   (req: <= 3)
Antibodies: 308   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 173.99   (req: >= 5)
Gene RIFs: 89   (req: > 3)
Antibodies: 308   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 18
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 6
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
terfenadine
chemical structure image
Pathways (24)
Arachidonic acid metabolism (R-HSA-2142753)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 10
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Arachidonic acid metabolism
Reactome
Biological oxidations
Reactome
Cytochrome P450 - arranged by substrate type
Reactome
Fatty acid metabolism
Reactome
Fatty acids
Name
Explore in Pharos
Explore in Source
Arachidonic acid metabolism
Biological oxidations
Cytochrome P450 - arranged by substrate type
Fatty acid metabolism
Fatty acids
Gene Ontology Terms (23)
Items per page:
10
1 – 10 of 10
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (95)
1 – 10 of 95
MINDY2
Tbio
Novelty: 0.5060241
p_int: 0.999999771
p_ni: 1.24e-7
p_wrong: 1.05e-7
Score: 0.252
Data Source: BioPlex,STRINGDB
TIPIN
Tbio
Novelty: 0.03596048
p_int: 0.999996851
p_ni: 0.000002839
p_wrong: 3.1e-7
Data Source: BioPlex
ECPAS
Tbio
Novelty: 0.05663049
p_int: 0.999996236
p_ni: 0.000003764
Data Source: BioPlex
NELFB
Tbio
Novelty: 0.07360458
p_int: 0.999879617
p_ni: 0.000120383
Data Source: BioPlex
PDE4DIP
Tbio
Novelty: 0.04181178
p_int: 0.999696229
p_ni: 0.000264254
p_wrong: 0.000039516
Data Source: BioPlex
USP25
Tbio
Family: Enzyme
Novelty: 0.02945953
p_int: 0.999382772
p_ni: 0.000617228
Data Source: BioPlex
PKD2
Tchem
Family: IC
Novelty: 0.00208049
p_int: 0.999189282
p_ni: 0.000810718
Data Source: BioPlex
VPS28
Tbio
Novelty: 0.04542177
p_int: 0.999017469
p_ni: 0.000970666
p_wrong: 0.000011865
Data Source: BioPlex
LRBA
Tbio
Novelty: 0.00096206
p_int: 0.998352227
p_ni: 0.001647773
Data Source: BioPlex
NELFE
Tbio
Novelty: 0.03438261
p_int: 0.997102325
p_ni: 0.00289629
p_wrong: 0.000001385
Data Source: BioPlex
Publication Statistics
PubMed Score  173.99

PubMed score by year
PubTator Score  138.83

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLAAMGSLAAALWAVVHPRTLLLGTVAFLLAADFLKRRRPKNYPPGPWRLPFLGNFFLVDFEQSHLEVQL
1-70
FVKKYGNLFSLELGDISAVLITGLPLIKEALIHMDQNFGNRPVTPMREHIFKKNGLIMSSGQAWKEQRRF
70-140
TLTALRNFGLGKKSLEERIQEEAQHLTEAIKEENGQPFDPHFKINNAVSNIICSITFGERFEYQDSWFQQ
140-210
LLKLLDEVTYLEASKTCQLYNVFPWIMKFLPGPHQTLFSNWKKLKLFVSHMIDKHRKDWNPAETRDFIDA
210-280
YLKEMSKHTGNPTSSFHEENLICSTLDLFFAGTETTSTTLRWALLYMALYPEIQEKVQAEIDRVIGQGQQ
280-350
PSTAARESMPYTNAVIHEVQRMGNIIPLNVPREVTVDTTLAGYHLPKGTMILTNLTALHRDPTEWATPDT
350-420
FNPDHFLENGQFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFRPPNNEKLSLKFRMGITIS
420-490
PVSHRLCAVPQV
490-502
MLAAMGSLAAALWAVVHPRTLLLGTVAFLLAADFLKRRRPKNYPPGPWRLPFLGNFFLVDFEQSHLEVQLFVKKYGNLFSLELGDISAVLITGLPLIKEALIHMDQNFGNRPVTPMREHIFKKNGLIMSSGQAWKEQRRFTLTALRNFGLGKKSLEERIQEEAQHLTEAIKEENGQPFDPHFKINNAVSNIICSITFGERFEYQDSWFQQLLKLLDEVTYLEASKTCQLYNVFPWIMKFLPGPHQTLFSNWKKLKLFVSHMIDKHRKDWNPAETRDFIDAYLKEMSKHTGNPTSSFHEENLICSTLDLFFAGTETTSTTLRWALLYMALYPEIQEKVQAEIDRVIGQGQQPSTAARESMPYTNAVIHEVQRMGNIIPLNVPREVTVDTTLAGYHLPKGTMILTNLTALHRDPTEWATPDTFNPDHFLENGQFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFRPPNNEKLSLKFRMGITISPVSHRLCAVPQV