You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
NOVA1
RNA-binding protein Nova-1

Protein Summary
Description
May regulate RNA splicing or metabolism in a specific subset of developing neurons. This gene encodes a neuron-specific RNA-binding protein, a member of the Nova family of paraneoplastic disease antigens, that is recognized and inhibited by paraneoplastic antibodies. These antibodies are found in the sera of patients with paraneoplastic opsoclonus-ataxia, breast cancer, and small cell lung cancer. Alternatively spliced transcripts encoding distinct isoforms have been described. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000344429
  • ENSP00000342387
  • ENSG00000139910
  • ENST00000465357
  • ENSP00000447391
  • ENST00000539517
  • ENSP00000438875

Symbol
  • Nova-1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
PubMedID
0.72
histone modification site profile
0.65
cellular component
0.61
microRNA
0.61
trait
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 62.12   (req: < 5)
Gene RIFs: 15   (req: <= 3)
Antibodies: 238   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 62.12   (req: >= 5)
Gene RIFs: 15   (req: > 3)
Antibodies: 238   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (12)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (98)
1 – 10 of 98
NOVA2
Tbio
Novelty: 0.02462595
p_int: 1
Score: 0.747
Data Source: BioPlex,STRINGDB
GRIA2
Tclin
Family: IC
Novelty: 0.00187801
Score: 0.784
Data Source: STRINGDB
PTBP2
Tbio
Novelty: 0.00788786
Score: 0.771
Data Source: STRINGDB
RBFOX1
Tbio
Novelty: 0.00800456
Score: 0.768
Data Source: STRINGDB
HNRNPM
Tbio
Novelty: 0.01865149
Score: 0.764
Data Source: STRINGDB
RBFOX2
Tbio
Novelty: 0.01237106
Score: 0.749
Data Source: STRINGDB
FAM107B
Tbio
Novelty: 0.00158444
Score: 0.711
Data Source: STRINGDB
NRXN3
Tbio
Novelty: 0.01732789
Score: 0.705
Data Source: STRINGDB
NRXN3
Tbio
Novelty: 0.01732789
Score: 0.705
Data Source: STRINGDB
PTBP1
Tbio
Novelty: 0.00204645
Score: 0.704
Data Source: STRINGDB
Publication Statistics
PubMed Score  62.12

PubMed score by year
PubTator Score  45.01

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MMAAAPIQQNGTHTGVPIDLDPPDSRKRPLEAPPEAGSTKRTNTGEDGQYFLKVLIPSYAAGSIIGKGGQ
1-70
TIVQLQKETGATIKLSKLSKSKDFYPGTTERVCLIQGTVEALNAVHGFIAEKIREMPQNVAKTEPVSILQ
70-140
PQTTVNPDRIKQTLPSSPTTTKSSPSDPMTTSRANQVKIIVPNSTAGLIIGKGGATVKAVMEQSGAWVQL
140-210
SQKPDGINLQERVVTVSGEPEQNRKAVELIIQKIQEDPQSGSCLNISYANVTGPVANSNPTGSPYANTAE
210-280
VLPTAAAAAGLLGHANLAGVAAFPAVLSGFTGNDLVAITSALNTLASYGYNLNTLGLGLSQAAATGALAA
280-350
AAASANPAAAAANLLATYASEASASGSTAGGTAGTFALGSLAAATAATNGYFGAASPLAASAILGTEKST
350-420
DGSKDVVEIAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFVPGTRNRKVTITGTPAATQAAQYL
420-490
ITQRITYEQGVRAANPQKVG
490-510
MMAAAPIQQNGTHTGVPIDLDPPDSRKRPLEAPPEAGSTKRTNTGEDGQYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKLSKSKDFYPGTTERVCLIQGTVEALNAVHGFIAEKIREMPQNVAKTEPVSILQPQTTVNPDRIKQTLPSSPTTTKSSPSDPMTTSRANQVKIIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQKPDGINLQERVVTVSGEPEQNRKAVELIIQKIQEDPQSGSCLNISYANVTGPVANSNPTGSPYANTAEVLPTAAAAAGLLGHANLAGVAAFPAVLSGFTGNDLVAITSALNTLASYGYNLNTLGLGLSQAAATGALAAAAASANPAAAAANLLATYASEASASGSTAGGTAGTFALGSLAAATAATNGYFGAASPLAASAILGTEKSTDGSKDVVEIAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG