You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
SCNN1B
Amiloride-sensitive sodium channel subunit beta

Protein Summary
Description
Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Plays an essential role in electrolyte and blood pressure homeostasis, but also in airway surface liquid homeostasis, which is important for proper clearance of mucus. Controls the reabsorption of sodium in kidney, colon, lung and sweat glands. Also plays a role in taste perception. Nonvoltage-gated, amiloride-sensitive, sodium channels control fluid and electrolyte transport across epithelia in many organs. These channels are heteromeric complexes consisting of 3 subunits: alpha, beta, and gamma. This gene encodes the beta subunit, and mutations in this gene have been associated with pseudohypoaldosteronism type 1 (PHA1), and Liddle syndrome. [provided by RefSeq, Apr 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000307331
  • ENSP00000302874
  • ENSG00000168447
  • ENST00000343070
  • ENSP00000345751

Symbol
  • BESC1
  • ENaCb
  • SCNEB
  • LIDLS1
  • ENaCbeta
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.84
phenotype
0.66
biological term
0.65
virus perturbation
0.64
chemical
0.6


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 59.14   (req: < 5)
Gene RIFs: 78   (req: <= 3)
Antibodies: 415   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 59.14   (req: >= 5)
Gene RIFs: 78   (req: > 3)
Antibodies: 415   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 2
Pathways (5)
Ion channel transport (R-HSA-983712)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Ion channel transport
Reactome
Stimuli-sensing channels
Reactome
Transport of small molecules
Name
Explore in Pharos
Explore in Source
Ion channel transport
Stimuli-sensing channels
Transport of small molecules
Gene Ontology Terms (16)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
BHF-UCL
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (80)
1 – 10 of 80
NEDD4L
Tbio
Family: Enzyme
Novelty: 0.00294229
Score: 0.983
Data Source: STRINGDB
SGK1
Tchem
Family: Kinase
Novelty: 0.00194497
Score: 0.965
Data Source: STRINGDB
SCNN1G
Tclin
Family: IC
Novelty: 0.00766423
Score: 0.957
Data Source: Reactome,STRINGDB
WNK4
Tbio
Family: Kinase
Novelty: 0.00882642
Score: 0.955
Data Source: STRINGDB
SCNN1A
Tclin
Family: IC
Novelty: 0.01452921
Score: 0.954
Data Source: Reactome,STRINGDB
SCNN1D
Tbio
Family: IC
Novelty: 0.06253257
Score: 0.947
Data Source: Reactome,STRINGDB
TSC22D3
Tbio
Family: TF
Novelty: 0.00711248
Score: 0.943
Data Source: STRINGDB
WNK1
Tchem
Family: Kinase
Novelty: 0.00147233
Score: 0.943
Data Source: STRINGDB
WNK3
Tchem
Family: Kinase
Novelty: 0.04155741
Score: 0.941
Data Source: STRINGDB
RAF1
Tclin
Family: Kinase
Novelty: 0.00165174
Score: 0.94
Data Source: STRINGDB
Publication Statistics
PubMed Score  59.14

PubMed score by year
PubTator Score  59.69

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MHVKKYLLKGLHRLQKGPGYTYKELLVWYCDNTNTHGPKRIICEGPKKKAMWFLLTLLFAALVCWQWGIF
1-70
IRTYLSWEVSVSLSVGFKTMDFPAVTICNASPFKYSKIKHLLKDLDELMEAVLERILAPELSHANATRNL
70-140
NFSIWNHTPLVLIDERNPHHPMVLDLFGDNHNGLTSSSASEKICNAHGCKMAMRLCSLNRTQCTFRNFTS
140-210
ATQALTEWYILQATNIFAQVPQQELVEMSYPGEQMILACLFGAEPCNYRNFTSIFYPHYGNCYIFNWGMT
210-280
EKALPSANPGTEFGLKLILDIGQEDYVPFLASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDK
280-350
LQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLPRGEKYCNNRDF
350-420
PDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLSQERDQSTNITLSRK
420-490
GIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWITIIKLVALAK
490-560
SLRQRRAQASYAGPPPTVAELVEAHTNFGFQPDTAPRSPNTGPYPSEQALPIPGTPPPNYDSLRLQPLDV
560-630
IESDSEGDAI
630-640
MHVKKYLLKGLHRLQKGPGYTYKELLVWYCDNTNTHGPKRIICEGPKKKAMWFLLTLLFAALVCWQWGIFIRTYLSWEVSVSLSVGFKTMDFPAVTICNASPFKYSKIKHLLKDLDELMEAVLERILAPELSHANATRNLNFSIWNHTPLVLIDERNPHHPMVLDLFGDNHNGLTSSSASEKICNAHGCKMAMRLCSLNRTQCTFRNFTSATQALTEWYILQATNIFAQVPQQELVEMSYPGEQMILACLFGAEPCNYRNFTSIFYPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILDIGQEDYVPFLASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLPRGEKYCNNRDFPDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLSQERDQSTNITLSRKGIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWITIIKLVALAKSLRQRRAQASYAGPPPTVAELVEAHTNFGFQPDTAPRSPNTGPYPSEQALPIPGTPPPNYDSLRLQPLDVIESDSEGDAI