You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
FXR1
Fragile X mental retardation syndrome-related protein 1

Protein Summary
Description
RNA-binding protein required for embryonic and postnatal development of muscle tissue. May regulate intracellular transport and local translation of certain mRNAs (By similarity). The protein encoded by this gene is an RNA binding protein that interacts with the functionally-similar proteins FMR1 and FXR2. These proteins shuttle between the nucleus and cytoplasm and associate with polyribosomes, predominantly with the 60S ribosomal subunit. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000305586
  • ENSP00000307633
  • ENSG00000114416
  • ENST00000357559
  • ENSP00000350170
  • ENST00000445140
  • ENSP00000388828

Symbol
  • FXR1P
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.97
virus perturbation
0.96
kinase perturbation
0.95
interacting protein
0.9
transcription factor binding site profile
0.77


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 61.67   (req: < 5)
Gene RIFs: 26   (req: <= 3)
Antibodies: 281   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 61.67   (req: >= 5)
Gene RIFs: 26   (req: > 3)
Antibodies: 281   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 14
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (83)
Disease (R-HSA-1643685)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Disease
Reactome
Diseases of signal transduction
Reactome
Oncogenic MAPK signaling
Reactome
Signaling by BRAF and RAF fusions
Name
Explore in Pharos
Explore in Source
Disease
Diseases of signal transduction
Oncogenic MAPK signaling
Signaling by BRAF and RAF fusions
Gene Ontology Terms (29)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (187)
1 – 10 of 187
LGALS3BP
Tbio
Novelty: 0.00116733
p_int: 0.997015163
p_ni: 0.002984837
Score: 0.161
Data Source: BioPlex,STRINGDB
RRP8
Tbio
Family: Enzyme
Novelty: 0.00456854
p_int: 0.985506263
p_ni: 0.014493737
Score: 0.151
Data Source: BioPlex,STRINGDB
FXR2
Tbio
Family: Epigenetic
Novelty: 0.04147056
p_int: 0.971236919
p_ni: 0.02876307
p_wrong: 1.1e-8
Score: 0.964
Data Source: BioPlex,STRINGDB
GPSM3
Tbio
Novelty: 0.0098187
p_int: 0.965914561
p_ni: 0.034085439
Data Source: BioPlex
MAP7
Tbio
Novelty: 0.02738196
p_int: 0.952103855
p_ni: 0.047896145
Data Source: BioPlex
MAGEA4
Tbio
Novelty: 0.00987373
p_int: 0.948251564
p_ni: 0.051748436
Score: 0.195
Data Source: BioPlex,STRINGDB
PINX1
Tbio
Family: TF
Novelty: 0.00961502
p_int: 0.945056657
p_ni: 0.054943343
Score: 0.228
Data Source: BioPlex,STRINGDB
PLEKHO1
Tbio
Novelty: 0.01414157
p_int: 0.914213198
p_ni: 0.085786802
Data Source: BioPlex
CHCHD4
Tbio
Novelty: 0.01246396
p_int: 0.853766282
p_ni: 0.146233718
Data Source: BioPlex
ZNF512
Tbio
Family: TF
Novelty: 0.19294377
p_int: 0.845122008
p_ni: 0.154877992
Data Source: BioPlex
Publication Statistics
PubMed Score  61.67

PubMed score by year
PubTator Score  42.72

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAELTVEVRGSNGAFYKGFIKDVHEDSLTVVFENNWQPERQVPFNEVRLPPPPDIKKEISEGDEVEVYSR
1-70
ANDQEPCGWWLAKVRMMKGEFYVIEYAACDATYNEIVTFERLRPVNQNKTVKKNTFFKCTVDVPEDLREA
70-140
CANENAHKDFKKAVGACRIFYHPETTQLMILSASEATVKRVNILSDMHLRSIRTKLMLMSRNEEATKHLE
140-210
CTKQLAAAFHEEFVVREDLMGLAIGTHGSNIQQARKVPGVTAIELDEDTGTFRIYGESADAVKKARGFLE
210-280
FVEDFIQVPRNLVGKVIGKNGKVIQEIVDKSGVVRVRIEGDNENKLPREDGMVPFVFVGTKESIGNVQVL
280-350
LEYHIAYLKEVEQLRMERLQIDEQLRQIGSRSYSGRGRGRRGPNYTSGYGTNSELSNPSETESERKDELS
350-420
DWSLAGEDDRDSRHQRDSRRRPGGRGRSVSGGRGRGGPRGGKSSISSVLKDPDSNPYSLLDNTESDQTAD
420-490
TDASESHHSTNRRRRSRRRRTDEDAVLMDGMTESDTASVNENGLVTVADYISRAESQSRQRNLPRETLAK
490-560
NKKEMAKDVIEEHGPSEKAINGPTSASGDDISKLQRTPGEEKINTLKEENTQEAAVLNGVS
560-621
MAELTVEVRGSNGAFYKGFIKDVHEDSLTVVFENNWQPERQVPFNEVRLPPPPDIKKEISEGDEVEVYSRANDQEPCGWWLAKVRMMKGEFYVIEYAACDATYNEIVTFERLRPVNQNKTVKKNTFFKCTVDVPEDLREACANENAHKDFKKAVGACRIFYHPETTQLMILSASEATVKRVNILSDMHLRSIRTKLMLMSRNEEATKHLECTKQLAAAFHEEFVVREDLMGLAIGTHGSNIQQARKVPGVTAIELDEDTGTFRIYGESADAVKKARGFLEFVEDFIQVPRNLVGKVIGKNGKVIQEIVDKSGVVRVRIEGDNENKLPREDGMVPFVFVGTKESIGNVQVLLEYHIAYLKEVEQLRMERLQIDEQLRQIGSRSYSGRGRGRRGPNYTSGYGTNSELSNPSETESERKDELSDWSLAGEDDRDSRHQRDSRRRPGGRGRSVSGGRGRGGPRGGKSSISSVLKDPDSNPYSLLDNTESDQTADTDASESHHSTNRRRRSRRRRTDEDAVLMDGMTESDTASVNENGLVTVADYISRAESQSRQRNLPRETLAKNKKEMAKDVIEEHGPSEKAINGPTSASGDDISKLQRTPGEEKINTLKEENTQEAAVLNGVS