You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TOB1
Protein Tob1

Protein Summary
Description
Anti-proliferative protein; the function is mediated by association with deadenylase subunits of the CCR4-NOT complex (PubMed:8632892, PubMed:23236473). Mediates CPEB3-accelerated mRNA deadenylation by binding to CPEB3 and recruiting CNOT7 which leads to target mRNA deadenylation and decay (PubMed:21336257). This gene encodes a member of the transducer of erbB-2 /B-cell translocation gene protein family. Members of this family are anti-proliferative factors that have the potential to regulate cell growth. The encoded protein may function as a tumor suppressor. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Aug 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000268957
  • ENSP00000268957
  • ENSG00000141232
  • ENST00000499247
  • ENSP00000427695

Symbol
  • TOB
  • TROB1
  • TOB
  • TROB
  • APRO5
  • APRO6
  • PIG49
  • TROB1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.98
PubMedID
0.95
transcription factor binding site profile
0.94
transcription factor perturbation
0.91
biological process
0.86


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 51.5   (req: < 5)
Gene RIFs: 32   (req: <= 3)
Antibodies: 256   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 51.5   (req: >= 5)
Gene RIFs: 32   (req: > 3)
Antibodies: 256   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Protein-Protein Interactions (46)
1 – 10 of 46
CNOT6
Tbio
Novelty: 0.04777339
p_int: 0.999999939
p_ni: 6.1e-8
Score: 0.983
Data Source: BioPlex,STRINGDB
CNOT6L
Tbio
Novelty: 0.07783019
p_int: 0.999999536
p_ni: 4.63e-7
p_wrong: 1e-9
Score: 0.987
Data Source: BioPlex,STRINGDB
CNOT2
Tbio
Novelty: 0.00141101
p_int: 0.999997014
p_ni: 0.000002986
Score: 0.963
Data Source: BioPlex,STRINGDB
TNKS1BP1
Tbio
Family: Enzyme
Novelty: 0.47529234
p_int: 0.999994502
p_ni: 0.000005498
Score: 0.976
Data Source: BioPlex,STRINGDB
CNOT7
Tchem
Novelty: 0.05810846
p_int: 0.999991842
p_ni: 0.000008153
p_wrong: 4e-9
Score: 0.999
Data Source: BioPlex,STRINGDB
CNOT3
Tbio
Novelty: 0.00159271
p_int: 0.999991484
p_ni: 0.000008516
Score: 0.978
Data Source: BioPlex,STRINGDB
CNOT9
Tbio
Novelty: 0.09045388
p_int: 0.999978319
p_ni: 0.000021681
Score: 0.964
Data Source: BioPlex,STRINGDB
CNOT11
Tbio
Novelty: 0.06871944
p_int: 0.999957788
p_ni: 0.000042212
Score: 0.984
Data Source: BioPlex,STRINGDB
CNOT8
Tbio
Novelty: 0.01657925
p_int: 0.999902366
p_ni: 0.000097606
p_wrong: 2.8e-8
Score: 0.993
Data Source: BioPlex,STRINGDB
CNOT1
Tbio
Novelty: 0.00726919
p_int: 0.999892234
p_ni: 0.000107766
Score: 0.982
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  51.50

PubMed score by year
PubTator Score  127.05

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIGEKVDPVIEQ
1-70
ASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVKVLYVDDNNENGCELDKEIKNSFNPEAQVFM
70-140
PISDPASSVSSSPSPPFGHSAAVSPTFMPRSTQPLTFTTATFAATKFGSTKMKNSGRSNKVARTSPINLG
140-210
LNVNDLLKQKAISSSMHSLYGLGLGSQQQPQQQQQPAQPPPPPPPPQQQQQQKTSALSPNAKEFIFPNMQ
210-280
GQGSSTNGMFPGDSPLNLSPLQYSNAFDVFAAYGGLNEKSFVDGLNFSLNNMQYSNQQFQPVMAN
280-345
MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIGEKVDPVIEQASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVKVLYVDDNNENGCELDKEIKNSFNPEAQVFMPISDPASSVSSSPSPPFGHSAAVSPTFMPRSTQPLTFTTATFAATKFGSTKMKNSGRSNKVARTSPINLGLNVNDLLKQKAISSSMHSLYGLGLGSQQQPQQQQQPAQPPPPPPPPQQQQQQKTSALSPNAKEFIFPNMQGQGSSTNGMFPGDSPLNLSPLQYSNAFDVFAAYGGLNEKSFVDGLNFSLNNMQYSNQQFQPVMAN