You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MXI1
Max-interacting protein 1

Protein Summary
Description
Transcriptional repressor. MXI1 binds with MAX to form a sequence-specific DNA-binding protein complex which recognizes the core sequence 5'-CAC[GA]TG-3'. MXI1 thus antagonizes MYC transcriptional activity by competing for MAX. Expression of the c-myc gene, which produces an oncogenic transcription factor, is tightly regulated in normal cells but is frequently deregulated in human cancers. The protein encoded by this gene is a transcriptional repressor thought to negatively regulate MYC function, and is therefore a potential tumor suppressor. This protein inhibits the transcriptional activity of MYC by competing for MAX, another basic helix-loop-helix protein that binds to MYC and is required for its function. Defects in this gene are frequently found in patients with prostate tumors. Three alternatively spliced transcripts encoding different isoforms have been described. Additional alternatively spliced transcripts may exist but the products of these transcripts have not been verified ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000239007
  • ENSP00000239007
  • ENSG00000119950
  • ENST00000332674
  • ENSP00000331152
  • ENST00000361248
  • ENSP00000354606
  • ENST00000369612
  • ENSP00000358625

Symbol
  • BHLHC11
  • MXI
  • MAD2
  • MXD2
  • bHLHc11
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.95
transcription factor
0.95
transcription factor binding site profile
0.9
PubMedID
0.82
microRNA
0.75


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 134.76   (req: < 5)
Gene RIFs: 21   (req: <= 3)
Antibodies: 228   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 134.76   (req: >= 5)
Gene RIFs: 21   (req: > 3)
Antibodies: 228   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (47)
1 – 10 of 47
MAX
Tbio
Family: TF
Novelty: 0.00681918
p_int: 0.999996691
p_ni: 3e-9
p_wrong: 0.000003306
Score: 0.842
Data Source: BioPlex,STRINGDB
MXD3
Tbio
Family: TF
Novelty: 0.0079582
p_int: 0.972751106
p_ni: 5.57e-7
p_wrong: 0.027248337
Score: 0.266
Data Source: BioPlex,STRINGDB
BTRC
Tbio
Novelty: 0.00393331
p_int: 0.965607934
p_ni: 3.04e-7
p_wrong: 0.034391763
Score: 0.263
Data Source: BioPlex,STRINGDB
SIN3A
Tbio
Novelty: 0.01059111
Score: 0.83
Data Source: STRINGDB
MYC
Tbio
Family: TF
Novelty: 0.000073
Score: 0.774
Data Source: STRINGDB
SIN3B
Tbio
Novelty: 0.04173216
Score: 0.768
Data Source: STRINGDB
RIOK3
Tchem
Family: Kinase
Novelty: 0.07096405
Score: 0.712
Data Source: STRINGDB
TMCO5A
Tdark
Novelty: 0.54794521
Score: 0.684
Data Source: STRINGDB
TMEM225
Tdark
Novelty: 0.56277056
Score: 0.68
Data Source: STRINGDB
DHRS12
Tdark
Family: Enzyme
Novelty: 0.65454545
Score: 0.68
Data Source: STRINGDB
Publication Statistics
PubMed Score  134.76

PubMed score by year
PubTator Score  80.81

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MERVKMINVQRLLEAAEFLERRERECEHGYASSFPSMPSPRLQHSKPPRRLSRAQKHSSGSSNTSTANRS
1-70
THNELEKNRRAHLRLCLERLKVLIPLGPDCTRHTTLGLLNKAKAHIKKLEEAERKSQHQLENLEREQRFL
70-140
KWRLEQLQGPQEMERIRMDSIGSTISSDRSDSEREEIEVDVESTEFSHGEVDNISTTSISDIDDHSSLPS
140-210
IGSDEGYSSASVKLSFTS
210-228
MERVKMINVQRLLEAAEFLERRERECEHGYASSFPSMPSPRLQHSKPPRRLSRAQKHSSGSSNTSTANRSTHNELEKNRRAHLRLCLERLKVLIPLGPDCTRHTTLGLLNKAKAHIKKLEEAERKSQHQLENLEREQRFLKWRLEQLQGPQEMERIRMDSIGSTISSDRSDSEREEIEVDVESTEFSHGEVDNISTTSISDIDDHSSLPSIGSDEGYSSASVKLSFTS