You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GDI2
Rab GDP dissociation inhibitor beta

Protein Summary
Description
Regulates the GDP/GTP exchange reaction of most Rab proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them. GDP dissociation inhibitors are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, small GTP-binding proteins of the ras superfamily, that are involved in vesicular trafficking of molecules between cellular organelles. GDIs slow the rate of dissociation of GDP from rab proteins and release GDP from membrane-bound rabs. GDI2 is ubiquitously expressed. The GDI2 gene contains many repetitive elements indicating that it may be prone to inversion/deletion rearrangements. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000380181
  • ENSP00000369528
  • ENSG00000057608
  • ENST00000380191
  • ENSP00000369538

Symbol
  • RABGDIB
  • RABGDIB
  • HEL-S-46e
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
interacting protein
0.99
kinase perturbation
0.99
virus perturbation
0.97
disease perturbation
0.96
co-expressed gene
0.93


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 26.97   (req: < 5)
Gene RIFs: 3   (req: <= 3)
Antibodies: 225   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 26.97   (req: >= 5)
Gene RIFs: 3   (req: > 3)
Antibodies: 225   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (11)
Immune System (R-HSA-168256)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 10
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Immune System
Reactome
Innate Immune System
Reactome
Membrane Trafficking
Reactome
Neutrophil degranulation
Reactome
RAB GEFs exchange GTP for GDP on RABs
Name
Explore in Pharos
Explore in Source
Immune System
Innate Immune System
Membrane Trafficking
Neutrophil degranulation
RAB GEFs exchange GTP for GDP on RABs
Protein-Protein Interactions (288)
1 – 10 of 288
RAB43
Tbio
Family: Enzyme
Novelty: 0.02494975
p_int: 0.999921328
p_ni: 0.000078673
Score: 0.42
Data Source: BioPlex,STRINGDB
RAB1B
Tbio
Family: Enzyme
Novelty: 0.02840676
p_int: 0.99979229
p_ni: 0.00020771
Score: 0.997
Data Source: BioPlex,STRINGDB
RAB9A
Tbio
Family: Enzyme
Novelty: 0.08341753
p_int: 0.999019754
p_ni: 0.000980246
Score: 0.979
Data Source: BioPlex,Reactome,STRINGDB
RAB1A
Tbio
Family: Enzyme
Novelty: 0.00379278
p_int: 0.997803131
p_ni: 0.002196869
Score: 0.997
Data Source: BioPlex,Reactome,STRINGDB
FN1
Tchem
Novelty: 0.0000437
p_int: 0.994568467
p_ni: 0.005431533
Score: 0.165
Data Source: BioPlex,STRINGDB
RAB2B
Tdark
Family: Enzyme
Novelty: 0.27592248
p_int: 0.99369691
p_ni: 0.006303091
Score: 0.346
Data Source: BioPlex,STRINGDB
C10orf88
Tdark
Novelty: 0.68515498
p_int: 0.980189479
p_ni: 0.019810521
Data Source: BioPlex
GDI1
Tbio
Novelty: 0.02210681
p_int: 0.977515287
p_ni: 0.022484713
Score: 0.981
Data Source: BioPlex,STRINGDB
RAB5A
Tbio
Family: Enzyme
Novelty: 0.00149542
p_int: 0.964363113
p_ni: 0.035636887
Score: 0.99
Data Source: BioPlex,Reactome,STRINGDB
RAB31
Tbio
Family: Enzyme
Novelty: 0.05315085
p_int: 0.958567634
p_ni: 0.041432366
Score: 0.972
Data Source: BioPlex,Reactome,STRINGDB
Publication Statistics
PubMed Score  26.97

PubMed score by year
PubTator Score  17.58

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGR
1-70
DWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRF
70-140
RKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIK
140-210
LYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQL
210-280
ICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYI
280-350
AIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNI
350-420
YKRMTGSEFDFEEMKRKKNDIYGED
420-445
MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED