You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SEPHS1
Selenide, water dikinase 1

Protein Classes
Protein Summary
Description
Synthesizes selenophosphate from selenide and ATP. This gene encodes an enzyme that synthesizes selenophosphate from selenide and ATP. Selenophosphate is the selenium donor used to synthesize selenocysteine, which is co-translationally incorporated into selenoproteins at in-frame UGA codons. [provided by RefSeq, Sep 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000327347
  • ENSP00000367893
  • ENSG00000086475
  • ENST00000378614
  • ENSP00000367877
  • ENST00000545675
  • ENSP00000441119

Symbol
  • SELD
  • SPS
  • SPS1
  • SPS
  • SELD
  • SPS1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
1
kinase perturbation
0.98
molecular function
0.95
transcription factor perturbation
0.94
disease perturbation
0.9


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 58.21   (req: < 5)
Gene RIFs: 6   (req: <= 3)
Antibodies: 175   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 58.21   (req: >= 5)
Gene RIFs: 6   (req: > 3)
Antibodies: 175   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (13)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (78)
1 – 10 of 78
HLX
Tbio
Family: TF
Novelty: 0.01548354
p_int: 0.986423539
p_ni: 0.013576461
Score: 0.391
Data Source: BioPlex,STRINGDB
SEPSECS
Tbio
Family: Enzyme
Novelty: 0.00791538
Score: 0.986
Data Source: STRINGDB
SCLY
Tbio
Family: Enzyme
Novelty: 0.00286061
Score: 0.958
Data Source: STRINGDB
TXNRD2
Tbio
Family: Enzyme
Novelty: 0.00232135
Score: 0.93
Data Source: STRINGDB
TXNRD1
Tclin
Family: Enzyme
Novelty: 0.00387669
Score: 0.927
Data Source: STRINGDB
EEFSEC
Tbio
Novelty: 0.01180543
Score: 0.925
Data Source: STRINGDB
ACADS
Tbio
Family: Enzyme
Novelty: 0.00360385
Score: 0.878
Data Source: STRINGDB
SAE1
Tbio
Novelty: 0.02519067
Score: 0.84
Data Source: STRINGDB
DUT
Tchem
Family: Enzyme
Novelty: 0.003979
Score: 0.834
Data Source: STRINGDB
CRKL
Tbio
Novelty: 0.0061856
Score: 0.815
Data Source: STRINGDB
Publication Statistics
PubMed Score  58.21

PubMed score by year
PubTator Score  43.1

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSTRESFNPESYELDKSFRLTRFTELKGTGCKVPQDVLQKLLESLQENHFQEDEQFLGAVMPRLGIGMDT
1-70
CVIPLRHGGLSLVQTTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECDNMLMLLGVSNKMTDRERDKV
70-140
MPLIIQGFKDAAEEAGTSVTGGQTVLNPWIVLGGVATTVCQPNEFIMPDNAVPGDVLVLTKPLGTQVAVA
140-210
VHQWLDIPEKWNKIKLVVTQEDVELAYQEAMMNMARLNRTAAGLMHTFNAHAATDITGFGILGHAQNLAK
210-280
QQRNEVSFVIHNLPVLAKMAAVSKACGNMFGLMHGTCPETSGGLLICLPREQAARFCAEIKSPKYGEGHQ
280-350
AWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS
350-392
MSTRESFNPESYELDKSFRLTRFTELKGTGCKVPQDVLQKLLESLQENHFQEDEQFLGAVMPRLGIGMDTCVIPLRHGGLSLVQTTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECDNMLMLLGVSNKMTDRERDKVMPLIIQGFKDAAEEAGTSVTGGQTVLNPWIVLGGVATTVCQPNEFIMPDNAVPGDVLVLTKPLGTQVAVAVHQWLDIPEKWNKIKLVVTQEDVELAYQEAMMNMARLNRTAAGLMHTFNAHAATDITGFGILGHAQNLAKQQRNEVSFVIHNLPVLAKMAAVSKACGNMFGLMHGTCPETSGGLLICLPREQAARFCAEIKSPKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS