You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RGS3
Regulator of G-protein signaling 3

Protein Summary
Description
Down-regulates signaling from heterotrimeric G-proteins by increasing the GTPase activity of the alpha subunits, thereby driving them into their inactive GDP-bound form. Down-regulates G-protein-mediated release of inositol phosphates and activation of MAP kinases. This gene encodes a member of the regulator of G-protein signaling (RGS) family. This protein is a GTPase-activating protein that inhibits G-protein-mediated signal transduction. Alternative splicing and the use of alternative promoters results in multiple transcript variants encoding different isoforms. Long isoforms are largely cytosolic and plasma membrane-associated with a function in Wnt signaling and in the epithelial mesenchymal transition, while shorter N-terminally-truncated isoforms can be nuclear. [provided by RefSeq, Jan 2013]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000317613
  • ENSP00000312844
  • ENSG00000138835
  • ENST00000343817
  • ENSP00000340284
  • ENST00000350696
  • ENSP00000259406
  • ENST00000374134
  • ENSP00000363249
  • ENST00000374140
  • ENSP00000363255
  • ENST00000394646
  • ENSP00000378141
  • ENST00000462143
  • ENSP00000420356
  • ENST00000462403
  • ENSP00000436168
  • ENST00000613049
  • ENSP00000482612

Symbol
  • C2PA
  • RGP3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.95
virus perturbation
0.85
transcription factor
0.84
transcription factor perturbation
0.84
kinase perturbation
0.76


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 50.42   (req: < 5)
Gene RIFs: 19   (req: <= 3)
Antibodies: 158   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 50.42   (req: >= 5)
Gene RIFs: 19   (req: > 3)
Antibodies: 158   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (16)
G alpha (i) signalling events (R-HSA-418594)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
G alpha (i) signalling events
Reactome
G alpha (q) signalling events
Reactome
GPCR downstream signalling
Reactome
Signal Transduction
Reactome
Signaling by GPCR
Name
Explore in Pharos
Explore in Source
G alpha (i) signalling events
G alpha (q) signalling events
GPCR downstream signalling
Signal Transduction
Signaling by GPCR
Gene Ontology Terms (6)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (85)
1 – 10 of 85
CRAT
Tbio
Family: Enzyme
Novelty: 0.01538925
p_int: 1
Score: 0.187
Data Source: BioPlex,STRINGDB
UACA
Tbio
Novelty: 0.06528836
p_int: 0.999999966
p_ni: 3.4e-8
Score: 0.151
Data Source: BioPlex,STRINGDB
SKAP2
Tbio
Family: Enzyme
Novelty: 0.00344826
p_int: 0.99999809
p_ni: 0.00000191
p_wrong: 1e-9
Score: 0.195
Data Source: BioPlex,STRINGDB
CEP72
Tbio
Novelty: 0.11333799
p_int: 0.999997836
p_ni: 0.000002162
p_wrong: 2e-9
Data Source: BioPlex
RBAK
Tbio
Family: TF
Novelty: 0.15225666
p_int: 0.999992894
p_ni: 0.000007101
p_wrong: 6e-9
Score: 0.319
Data Source: BioPlex,STRINGDB
EFNB2
Tbio
Novelty: 0.00309066
p_int: 0.999977559
p_ni: 0.000022431
p_wrong: 1e-8
Score: 0.979
Data Source: BioPlex,STRINGDB
ATG9A
Tbio
Novelty: 0.02725439
p_int: 0.999976413
p_ni: 0.00002352
p_wrong: 6.7e-8
Data Source: BioPlex
ZKSCAN8
Tdark
Family: TF
Novelty: 0.35106383
p_int: 0.999971351
p_ni: 0.000028646
p_wrong: 4e-9
Score: 0.222
Data Source: BioPlex,STRINGDB
ZNF24
Tbio
Family: TF
Novelty: 0.02958008
p_int: 0.999969179
p_ni: 0.000030821
Data Source: BioPlex
REL
Tbio
Family: TF
Novelty: 0.0004693
p_int: 0.999961869
p_ni: 0.000038131
Data Source: BioPlex
Publication Statistics
PubMed Score  50.42

PubMed score by year
PubTator Score  34.17

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPVIPALWEVEMGRSQGQEIETILANRSHSDSTPLPNFLSGSHRPECCTCRLLTASGAQDSLPFGRRLYS
1-70
GPWRSCEEVCHVSVLSVLSTSCGLSLSLPIFPGWMEWLSPDIALPRRDEWTQTSPARKRITHAKVQGAGQ
70-140
LRLSIDAQDRVLLLHIIEGKGLISKQPGTCDPYVKISLIPEDSRLRHQKTQTVPDCRDPAFHEHFFFPVQ
140-210
EEDDQKRLLVTVWNRASQSRQSGLIGCMSFGVKSLLTPDKEISGWYYLLGEHLGRTKHLKVARRRLRPLR
210-280
DPLLRMPGGGDTENGKKLKITIPRGKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPVE
280-350
HWKCVELAHEIRSCPSEIILLVWRMVPQVKPGPDGGVLRRASCKSTHDLQSPPNKREKNCTHGVQARPEQ
350-420
RHSCHLVCDSSDGLLLGGWERYTEVAKRGGQHTLPALSRATAPTDPNYIILAPLNPGSQLLRPVYQEDTI
420-490
PEESGSPSKGKSYTGLGKKSRLMKTVQTMKGHGNYQNCPVVRPHATHSSYGTYVTLAPKVLVFPVFVQPL
490-560
DLCNPARTLLLSEELLLYEGRNKAAEVTLFAYSDLLLFTKEDEPGRCDVLRNPLYLQSVKLQEGSSEDLK
560-630
FCVLYLAEKAECLFTLEAHSQEQKKRVCWCLSENIAKQQQLAASPPDSKMFETEADEKREMALEEGKGPG
630-700
AEDSPPSKEPSPGQELPPGQDLPPNKDSPSGQEPAPSQEPLSSKDSATSEGSPPGPDAPPSKDVPPCQEP
700-770
PPAQDLSPCQDLPAGQEPLPHQDPLLTKDLPAIQESPTRDLPPCQDLPPSQVSLPAKALTEDTMSSGDLL
770-840
AATGDPPAAPRPAFVIPEVRLDSTYSQKAGAEQGCSGDEEDAEEAEEVEEGEEGEEDEDEDTSDDNYGER
840-910
SEAKRSSMIETGQGAEGGLSLRVQNSLRRRTHSEGSLLQEPRGPCFASDTTLHCSDGEGAASTWGMPSPS
910-980
TLKKELGRNGGSMHHLSLFFTGHRKMSGADTVGDDDEASRKRKSKNLAKDMKNKLGIFRRRNESPGAPPA
980-1050
GKADKMMKSFKPTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMAS
1050-1120
KAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLIN
1120-1190
QKKMSPPL
1190-1198
MPVIPALWEVEMGRSQGQEIETILANRSHSDSTPLPNFLSGSHRPECCTCRLLTASGAQDSLPFGRRLYSGPWRSCEEVCHVSVLSVLSTSCGLSLSLPIFPGWMEWLSPDIALPRRDEWTQTSPARKRITHAKVQGAGQLRLSIDAQDRVLLLHIIEGKGLISKQPGTCDPYVKISLIPEDSRLRHQKTQTVPDCRDPAFHEHFFFPVQEEDDQKRLLVTVWNRASQSRQSGLIGCMSFGVKSLLTPDKEISGWYYLLGEHLGRTKHLKVARRRLRPLRDPLLRMPGGGDTENGKKLKITIPRGKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPVEHWKCVELAHEIRSCPSEIILLVWRMVPQVKPGPDGGVLRRASCKSTHDLQSPPNKREKNCTHGVQARPEQRHSCHLVCDSSDGLLLGGWERYTEVAKRGGQHTLPALSRATAPTDPNYIILAPLNPGSQLLRPVYQEDTIPEESGSPSKGKSYTGLGKKSRLMKTVQTMKGHGNYQNCPVVRPHATHSSYGTYVTLAPKVLVFPVFVQPLDLCNPARTLLLSEELLLYEGRNKAAEVTLFAYSDLLLFTKEDEPGRCDVLRNPLYLQSVKLQEGSSEDLKFCVLYLAEKAECLFTLEAHSQEQKKRVCWCLSENIAKQQQLAASPPDSKMFETEADEKREMALEEGKGPGAEDSPPSKEPSPGQELPPGQDLPPNKDSPSGQEPAPSQEPLSSKDSATSEGSPPGPDAPPSKDVPPCQEPPPAQDLSPCQDLPAGQEPLPHQDPLLTKDLPAIQESPTRDLPPCQDLPPSQVSLPAKALTEDTMSSGDLLAATGDPPAAPRPAFVIPEVRLDSTYSQKAGAEQGCSGDEEDAEEAEEVEEGEEGEEDEDEDTSDDNYGERSEAKRSSMIETGQGAEGGLSLRVQNSLRRRTHSEGSLLQEPRGPCFASDTTLHCSDGEGAASTWGMPSPSTLKKELGRNGGSMHHLSLFFTGHRKMSGADTVGDDDEASRKRKSKNLAKDMKNKLGIFRRRNESPGAPPAGKADKMMKSFKPTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL