You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
VEGFC
Vascular endothelial growth factor C

Protein Summary
Description
Growth factor active in angiogenesis, and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in angiogenesis of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates KDR/VEGFR2 and FLT4/VEGFR3 receptors. The protein encoded by this gene is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family. The encoded protein promotes angiogenesis and endothelial cell growth, and can also affect the permeability of blood vessels. The proprotein is further cleaved into a fully processed form that can bind and activate VEGFR-2 and VEGFR-3 receptors. [provided by RefSeq, Apr 2014]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000618562
  • ENSP00000480043
  • ENSG00000150630

Symbol
  • VRP
  • Flt4-L
  • LMPH1D
  • LMPHM4
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
PubMedID
0.99
biological term
0.98
biological process
0.97
gene perturbation
0.97
transcription factor perturbation
0.94


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1115.98   (req: < 5)
Gene RIFs: 398   (req: <= 3)
Antibodies: 912   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1115.98   (req: >= 5)
Gene RIFs: 398   (req: > 3)
Antibodies: 912   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 29
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (33)
Hemostasis (R-HSA-109582)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 9
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Hemostasis
Reactome
Platelet activation, signaling and aggregation
Reactome
Platelet degranulation
Reactome
Response to elevated platelet cytosolic Ca2+
Reactome
Signal Transduction
Name
Explore in Pharos
Explore in Source
Hemostasis
Platelet activation, signaling and aggregation
Platelet degranulation
Response to elevated platelet cytosolic Ca2+
Signal Transduction
Protein-Protein Interactions (234)
1 – 10 of 234
FLT4
Tclin
Family: Kinase
Novelty: 0.00175479
Score: 0.999
Data Source: Reactome,STRINGDB
KDR
Tclin
Family: Kinase
Novelty: 0.00019671
Score: 0.999
Data Source: Reactome,STRINGDB
NRP2
Tbio
Novelty: 0.00918546
Score: 0.989
Data Source: STRINGDB
FN1
Tchem
Novelty: 0.0000437
Score: 0.975
Data Source: STRINGDB
THBS1
Tbio
Novelty: 0.00083403
Score: 0.97
Data Source: STRINGDB
FLT1
Tclin
Family: Kinase
Novelty: 0.00037168
Score: 0.967
Data Source: STRINGDB
HGF
Tchem
Family: Enzyme
Novelty: 0.00042012
Score: 0.954
Data Source: STRINGDB
PDGFB
Tchem
Novelty: 0.000542
Score: 0.954
Data Source: STRINGDB
EGF
Tbio
Novelty: 0.00015623
Score: 0.954
Data Source: STRINGDB
SERPINE1
Tchem
Novelty: 0.00020589
Score: 0.945
Data Source: STRINGDB
Publication Statistics
PubMed Score  1115.98

PubMed score by year
PubTator Score  932.44

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MHLLGFFSVACSLLAAALLPGPREAPAAAAAFESGLDLSDAEPDAGEATAYASKDLEEQLRSVSSVDELM
1-70
TVLYPEYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDV
70-140
GKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCR
140-210
CMSKLDVYRQVHSIIRRSLPATLPQCQAANKTCPTNYMWNNHICRCLAQEDFMFSSDAGDDSTDGFHDIC
210-280
GPNKELDEETCQCVCRAGLRPASCGPHKELDRNSCQCVCKNKLFPSQCGANREFDENTCQCVCKRTCPRN
280-350
QPLNPGKCACECTESPQKCLLKGKKFHHQTCSCYRRPCTNRQKACEPGFSYSEEVCRCVPSYWKRPQMS
350-419
MHLLGFFSVACSLLAAALLPGPREAPAAAAAFESGLDLSDAEPDAGEATAYASKDLEEQLRSVSSVDELMTVLYPEYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRSLPATLPQCQAANKTCPTNYMWNNHICRCLAQEDFMFSSDAGDDSTDGFHDICGPNKELDEETCQCVCRAGLRPASCGPHKELDRNSCQCVCKNKLFPSQCGANREFDENTCQCVCKRTCPRNQPLNPGKCACECTESPQKCLLKGKKFHHQTCSCYRRPCTNRQKACEPGFSYSEEVCRCVPSYWKRPQMS