You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
PGF
Placenta growth factor

Protein Summary
Description
Growth factor active in angiogenesis and endothelial cell growth, stimulating their proliferation and migration. It binds to the receptor FLT1/VEGFR-1. Isoform PlGF-2 binds NRP1/neuropilin-1 and NRP2/neuropilin-2 in a heparin-dependent manner. Also promotes cell tumor growth. This gene encodes a growth factor found in placenta which is homologous to vascular endothelial growth factor. Alternatively spliced transcripts encoding different isoforms have been found for this gene.[provided by RefSeq, Jun 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000405431
  • ENSP00000385365
  • ENSG00000119630
  • ENST00000553716
  • ENSP00000451413
  • ENST00000555567
  • ENSP00000451040

Symbol
  • PGFL
  • PLGF
  • PGFL
  • PIGF
  • PLGF
  • PlGF-2
  • D12S1900
  • SHGC-10760
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological term
0.97
PubMedID
0.69
disease
0.65
biological process
0.6
tissue
0.57


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3621.51   (req: < 5)
Gene RIFs: 297   (req: <= 3)
Antibodies: 860   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3621.51   (req: >= 5)
Gene RIFs: 297   (req: > 3)
Antibodies: 860   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 27
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 16
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
aflibercept
no chemical structure image available
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (17)
Signal Transduction (R-HSA-162582)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Signal Transduction
Reactome
Signaling by Receptor Tyrosine Kinases
Reactome
Signaling by VEGF
Reactome
VEGF binds to VEGFR leading to receptor dimerization
Reactome
VEGF ligand-receptor interactions
Name
Explore in Pharos
Explore in Source
Signal Transduction
Signaling by Receptor Tyrosine Kinases
Signaling by VEGF
VEGF binds to VEGFR leading to receptor dimerization
VEGF ligand-receptor interactions
Gene Ontology Terms (30)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (153)
1 – 10 of 153
FLT1
Tclin
Family: Kinase
Novelty: 0.00037168
Score: 0.999
Data Source: Reactome,STRINGDB
KDR
Tclin
Family: Kinase
Novelty: 0.00019671
Score: 0.984
Data Source: STRINGDB
VEGFA
Tclin
Novelty: 0.00004909
Score: 0.954
Data Source: STRINGDB
VEGFC
Tbio
Novelty: 0.00094058
Score: 0.927
Data Source: STRINGDB
VEGFD
Tbio
Novelty: 0.00329663
Score: 0.926
Data Source: STRINGDB
VEGFB
Tclin
Novelty: 0.00363465
Score: 0.922
Data Source: STRINGDB
PIK3CA
Tclin
Family: Kinase
Novelty: 0.00077082
Score: 0.915
Data Source: STRINGDB
FLT4
Tclin
Family: Kinase
Novelty: 0.00175479
Score: 0.91
Data Source: STRINGDB
PIK3R1
Tchem
Family: Kinase
Novelty: 0.00286014
Score: 0.906
Data Source: STRINGDB
PLCG1
Tchem
Family: Enzyme
Novelty: 0.00125418
Score: 0.902
Data Source: STRINGDB
Publication Statistics
PubMed Score  3621.51

PubMed score by year
PubTator Score  1605.97

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVE
1-70
HMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRHSPGRQSPD
70-140
MPGDFRADAPSFLPPRRSLPMLFRMEWGCALTGSQSAVWPSSPVPEEIPRMHPGRNGKKQQRKPLREKMK
140-210
PERCGDAVPRR
210-221
MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRHSPGRQSPDMPGDFRADAPSFLPPRRSLPMLFRMEWGCALTGSQSAVWPSSPVPEEIPRMHPGRNGKKQQRKPLREKMKPERCGDAVPRR