You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
NUMB
Protein numb homolog

Protein Classes
Protein Summary
Description
Plays a role in the process of neurogenesis. Required throughout embryonic neurogenesis to maintain neural progenitor cells, also called radial glial cells (RGCs), by allowing their daughter cells to choose progenitor over neuronal cell fate. Not required for the proliferation of neural progenitor cells before the onset of neurogenesis. Also involved postnatally in the subventricular zone (SVZ) neurogenesis by regulating SVZ neuroblasts survival and ependymal wall integrity. May also mediate local repair of brain ventricular wall damage. The protein encoded by this gene plays a role in the determination of cell fates during development. The encoded protein, whose degradation is induced in a proteasome-dependent manner by MDM2, is a membrane-bound protein that has been shown to associate with EPS15, LNX1, and NOTCH1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000355058
  • ENSP00000347169
  • ENSG00000133961
  • ENST00000356296
  • ENSP00000348644
  • ENST00000359560
  • ENSP00000352563
  • ENST00000535282
  • ENSP00000441258
  • ENST00000544991
  • ENSP00000446001
  • ENST00000554521
  • ENSP00000450817
  • ENST00000554546
  • ENSP00000452416
  • ENST00000555238
  • ENSP00000451300
  • ENST00000555394
  • ENSP00000451625
  • ENST00000555738
  • ENSP00000452069
  • ENST00000557597
  • ENSP00000451117
  • ENST00000559312
  • ENSP00000452888
  • ENST00000560335
  • ENSP00000453209

Symbol
  • C14orf41
  • S171
  • C14orf41
  • c14_5527
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
ligand (protein) perturbation
0.99
transcription factor perturbation
0.84
cellular component
0.78
disease perturbation
0.74
biological process
0.64


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 431.97   (req: < 5)
Gene RIFs: 78   (req: <= 3)
Antibodies: 743   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 431.97   (req: >= 5)
Gene RIFs: 78   (req: > 3)
Antibodies: 743   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 11
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (40)
Activated NOTCH1 Transmits Signal to the Nucleus (R-HSA-2122948)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 12
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activated NOTCH1 Transmits Signal to the Nucleus
Reactome
Axon guidance
Reactome
Degradation of GLI1 by the proteasome
Reactome
Developmental Biology
Reactome
Hedgehog 'off' state
Name
Explore in Pharos
Explore in Source
Activated NOTCH1 Transmits Signal to the Nucleus
Axon guidance
Degradation of GLI1 by the proteasome
Developmental Biology
Hedgehog 'off' state
Gene Ontology Terms (20)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from High Throughput Direct Assay (HDA)
BHF-UCL
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (212)
1 – 10 of 212
NUMBL
Tbio
Novelty: 0.02007066
p_int: 0.999999746
p_ni: 1e-9
p_wrong: 2.53e-7
Score: 0.81
Data Source: BioPlex,STRINGDB
AP2M1
Tbio
Novelty: 0.01240983
p_int: 0.99991049
p_ni: 0.00008951
Score: 0.451
Data Source: BioPlex,STRINGDB
KBTBD7
Tdark
Novelty: 1.01449275
p_int: 0.999811838
p_ni: 0.000151066
p_wrong: 0.000037095
Score: 0.303
Data Source: BioPlex,STRINGDB
UNC5CL
Tbio
Novelty: 0.19528828
p_int: 0.999019936
p_ni: 0.000980037
p_wrong: 2.7e-8
Score: 0.188
Data Source: BioPlex,STRINGDB
KLHL21
Tbio
Novelty: 0.51282051
p_int: 0.998302901
p_ni: 0.001472891
p_wrong: 0.000224209
Data Source: BioPlex
TULP3
Tbio
Family: TF
Novelty: 0.0888983
p_int: 0.994630319
p_ni: 0.004705278
p_wrong: 0.000664403
Score: 0.219
Data Source: BioPlex,STRINGDB
STAMBPL1
Tbio
Family: Enzyme
Novelty: 0.2201625
p_int: 0.99172125
p_ni: 0.006443876
p_wrong: 0.001834875
Score: 0.165
Data Source: BioPlex,STRINGDB
COL10A1
Tbio
Novelty: 0.00697565
p_int: 0.935987305
p_ni: 0.064002708
p_wrong: 0.000009988
Score: 0.214
Data Source: BioPlex,STRINGDB
PKD2
Tchem
Family: IC
Novelty: 0.00208049
p_int: 0.932465679
p_ni: 0.067532056
p_wrong: 0.000002264
Data Source: BioPlex
HSPA8
Tchem
Novelty: 0.00100906
p_int: 0.910635664
p_ni: 0.089364337
Data Source: BioPlex
Publication Statistics
PubMed Score  431.97

PubMed score by year
PubTator Score  341.28

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MNKLRQSFRRKKDVYVPEASRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICEDAVKRLKAERK
1-70
FFKGFFGKTGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPDRNFDRAFSYICRDGTTRRWI
70-140
CHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTATFDASRTTFTREGSFRVTTATEQAEREEIM
140-210
KQMQDAKKAETDKIVVGSSVAPGNTAPSPSSPTSPTSDATTSLEMNNPHAIPRRHAPIEQLARQGSFRGF
210-280
PALSQKMSPFKRQLSLRINELPSTMQRKTDFPIKNAVPEVEGEAESISSLCSQITNAFSTPEDPFSSAPM
280-350
TKPVTVVAPQSPTFQANGTDSAFHVLAKPAHTALAPVAMPVRETNPWAHAPDAANKEIAATCSGTEWGQS
350-420
SGAASPGLFQAGHRRTPSEADRWLEEVSKSVRAQQPQASAAPLQPVLQPPPPTAISQPASPFQGNAFLTS
420-490
QPVPVGVVPALQPAFVPAQSYPVANGMPYPAPNVPVVGITPSQMVANVFGTAGHPQAAHPHQSPSLVRQQ
490-560
TFPHYEASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASADRHTEVPTGTCPVDPFEAQWAALENKSKQR
560-630
TNPSPTNPFSSDLQKTFEIEL
630-651
MNKLRQSFRRKKDVYVPEASRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICEDAVKRLKAERKFFKGFFGKTGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPDRNFDRAFSYICRDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTATFDASRTTFTREGSFRVTTATEQAEREEIMKQMQDAKKAETDKIVVGSSVAPGNTAPSPSSPTSPTSDATTSLEMNNPHAIPRRHAPIEQLARQGSFRGFPALSQKMSPFKRQLSLRINELPSTMQRKTDFPIKNAVPEVEGEAESISSLCSQITNAFSTPEDPFSSAPMTKPVTVVAPQSPTFQANGTDSAFHVLAKPAHTALAPVAMPVRETNPWAHAPDAANKEIAATCSGTEWGQSSGAASPGLFQAGHRRTPSEADRWLEEVSKSVRAQQPQASAAPLQPVLQPPPPTAISQPASPFQGNAFLTSQPVPVGVVPALQPAFVPAQSYPVANGMPYPAPNVPVVGITPSQMVANVFGTAGHPQAAHPHQSPSLVRQQTFPHYEASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASADRHTEVPTGTCPVDPFEAQWAALENKSKQRTNPSPTNPFSSDLQKTFEIEL