You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
PRLHR
Prolactin-releasing peptide receptor

Protein Summary
Description
Receptor for prolactin-releasing peptide (PrRP). Implicated in lactation, regulation of food intake and pain-signal processing. PRLHR is a 7-transmembrane domain receptor for prolactin-releasing hormone (PRLH; MIM 602663) that is highly expressed in anterior pituitary (Ozawa et al., 2002 [PubMed 11923475]).[supplied by OMIM, Mar 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000239032
  • ENSP00000239032
  • ENSG00000119973
  • ENST00000636925
  • ENSP00000490073

Symbol
  • GPR10
  • GR3
  • GR3
  • GPR10
  • PrRPR
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.9
ligand (protein)
0.68
phenotype
0.54
cell line
0.5
molecular function
0.49


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 14.5   (req: < 5)
Gene RIFs: 11   (req: <= 3)
Antibodies: 267   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 14.5   (req: >= 5)
Gene RIFs: 11   (req: > 3)
Antibodies: 267   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 120
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (120)
1 – 10 of 120
Pathways (7)
Class A/1 (Rhodopsin-like receptors) (R-HSA-373076)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
GPCR ligand binding
Reactome
Peptide ligand-binding receptors
Reactome
Signal Transduction
Reactome
Signaling by GPCR
Name
Explore in Pharos
Explore in Source
Class A/1 (Rhodopsin-like receptors)
GPCR ligand binding
Peptide ligand-binding receptors
Signal Transduction
Signaling by GPCR
Protein-Protein Interactions (19)
1 – 10 of 19
PRLH
Tdark
Novelty: 0.00812683
Score: 0.989
Data Source: Reactome,STRINGDB
GRIP2
Tdark
Novelty: 0.13063139
Score: 0.779
Data Source: STRINGDB
NPFF
Tbio
Novelty: 0.00350925
Score: 0.732
Data Source: STRINGDB
QRFP
Tbio
Novelty: 0.02279173
Score: 0.713
Data Source: STRINGDB
PICK1
Tbio
Novelty: 0.00686801
Score: 0.693
Data Source: STRINGDB
GRIP1
Tbio
Novelty: 0.00647926
Score: 0.638
Data Source: STRINGDB
NPVF
Tdark
Novelty: 0.01666634
Score: 0.542
Data Source: STRINGDB
GPR150
Tdark
Family: GPCR
Novelty: 1.61864462
Score: 0.528
Data Source: STRINGDB
FAM19A5
Tdark
Novelty: 0.29098517
Score: 0.515
Data Source: STRINGDB
OR6N2
Tdark
Family: oGPCR
Score: 0.511
Data Source: STRINGDB
Publication Statistics
PubMed Score  14.50

PubMed score by year
PubTator Score  26.79

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MASSTTRGPRVSDLFSGLPPAVTTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLKGLIVLLYSVV
1-70
VVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCTACVPLTLAYAFEPRGWVFGGGLCHLVFFL
70-140
QPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLRLSAYAVLAIWALSAVLALPAAVHTYHVELKPHDVRL
140-210
CEEFWGSQERQRQLYAWGLLLVTYLLPLLVILLSYVRVSVKLRNRVVPGCVTQSQADWDRARRRRTFCLL
210-280
VVIVVVFAVCWLPLHVFNLLRDLDPHAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKLL
280-350
VAWPRKIAPHGQNMTVSVVI
350-370
MASSTTRGPRVSDLFSGLPPAVTTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLKGLIVLLYSVVVVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCTACVPLTLAYAFEPRGWVFGGGLCHLVFFLQPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLRLSAYAVLAIWALSAVLALPAAVHTYHVELKPHDVRLCEEFWGSQERQRQLYAWGLLLVTYLLPLLVILLSYVRVSVKLRNRVVPGCVTQSQADWDRARRRRTFCLLVVIVVVFAVCWLPLHVFNLLRDLDPHAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKLLVAWPRKIAPHGQNMTVSVVI