You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
CXCR3
C-X-C chemokine receptor type 3

Protein Summary
Description
Isoform 1: Receptor for the C-X-C chemokine CXCL9, CXCL10 and CXCL11 and mediates the proliferation, survival and angiogenic activity of human mesangial cells (HMC) through a heterotrimeric G-protein signaling pathway (PubMed:12782716). Binds to CCL21. Probably promotes cell chemotaxis response. Isoform 2: Receptor for the C-X-C chemokine CXCL4 and also mediates the inhibitory activities of CXCL9, CXCL10 and CXCL11 on the proliferation, survival and angiogenic activity of human microvascular endothelial cells (HMVEC) through a cAMP-mediated signaling pathway (PubMed:12782716). Does not promote cell chemotaxis respons. Interaction with CXCL4 or CXCL10 leads to activation of the p38MAPK pathway and contributes to inhibition of angiogenesis. Overexpression in renal cancer cells down-regulates expression of the anti-apoptotic protein HMOX1 and promotes apoptosis. Isoform 3: Mediates the activity of CXCL11. This gene encodes a G protein-coupled receptor with selectivity for three chemokines ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000373691
  • ENSP00000362795
  • ENSG00000186810
  • ENST00000373693
  • ENSP00000362797

Symbol
  • GPR9
  • GPR9
  • MigR
  • CD182
  • CD183
  • Mig-R
  • CKR-L2
  • CMKAR3
  • IP10-R
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
ligand (protein)
1
biological term
0.98
gene perturbation
0.69
cell type or tissue
0.68
molecular function
0.6


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 883.1   (req: < 5)
Gene RIFs: 219   (req: <= 3)
Antibodies: 966   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 883.1   (req: >= 5)
Gene RIFs: 219   (req: > 3)
Antibodies: 966   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 32
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 357
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (18)
Chemokine receptors bind chemokines (R-HSA-380108)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Chemokine receptors bind chemokines
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
G alpha (i) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Name
Explore in Pharos
Explore in Source
Chemokine receptors bind chemokines
Class A/1 (Rhodopsin-like receptors)
G alpha (i) signalling events
GPCR downstream signalling
GPCR ligand binding
Gene Ontology Terms (36)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (419)
1 – 10 of 419
CXCL10
Tchem
Novelty: 0.00051044
Score: 0.997
Data Source: Reactome,STRINGDB
CXCL9
Tbio
Novelty: 0.00107245
Score: 0.996
Data Source: Reactome,STRINGDB
CXCL11
Tbio
Novelty: 0.00172274
Score: 0.995
Data Source: Reactome,STRINGDB
PF4
Tbio
Novelty: 0.00046898
Score: 0.984
Data Source: STRINGDB
CCL5
Tchem
Novelty: 0.00039604
Score: 0.983
Data Source: STRINGDB
CXCL13
Tbio
Novelty: 0.00156696
Score: 0.977
Data Source: STRINGDB
CCL11
Tbio
Novelty: 0.00099166
Score: 0.975
Data Source: STRINGDB
CCL4
Tbio
Novelty: 0.00091965
Score: 0.974
Data Source: STRINGDB
CXCL12
Tbio
Novelty: 0.00031121
Score: 0.972
Data Source: STRINGDB
CCL21
Tbio
Novelty: 0.0007729
Score: 0.967
Data Source: STRINGDB
Publication Statistics
PubMed Score  883.10

PubMed score by year
PubTator Score  615.9

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDRAFLPALYSLLFLLGLLG
1-70
NGAVAAVLLSRRTALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFGSGLCKVAGALFNINFYAGAL
70-140
LLACISFDRYLNIVHATQLYRRGPPARVTLTCLAVWGLCLLFALPDFIFLSAHHDERLNATHCQYNFPQV
140-210
GRTALRVLQLVAGFLLPLLVMAYCYAHILAVLLVSRGQRRLRAMRLVVVVVVAFALCWTPYHLVVLVDIL
210-280
MDLGALARNCGRESRVDVAKSVTSGLGYMHCCLNPLLYAFVGVKFRERMWMLLLRLGCPNQRGLQRQPSS
280-350
SRRDSSWSETSEASYSGL
350-368
MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDRAFLPALYSLLFLLGLLGNGAVAAVLLSRRTALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNIVHATQLYRRGPPARVTLTCLAVWGLCLLFALPDFIFLSAHHDERLNATHCQYNFPQVGRTALRVLQLVAGFLLPLLVMAYCYAHILAVLLVSRGQRRLRAMRLVVVVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVAKSVTSGLGYMHCCLNPLLYAFVGVKFRERMWMLLLRLGCPNQRGLQRQPSSSRRDSSWSETSEASYSGL