You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TNNI2
Troponin I, fast skeletal muscle

Protein Summary
Description
Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity. This gene encodes a fast-twitch skeletal muscle protein, a member of the troponin I gene family, and a component of the troponin complex including troponin T, troponin C and troponin I subunits. The troponin complex, along with tropomyosin, is responsible for the calcium-dependent regulation of striated muscle contraction. Mouse studies show that this component is also present in vascular smooth muscle and may play a role in regulation of smooth muscle function. In addition to muscle tissues, this protein is found in corneal epithelium, cartilage where it is an inhibitor of angiogenesis to inhibit tumor growth and metastasis, and mammary gland where it functions as a co-activator of estrogen receptor-related receptor alpha. This protein also suppresses tumor growth in human ovarian carcinoma. Mutations in this gene cause ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000252898
  • ENSP00000252898
  • ENSG00000130598
  • ENST00000381905
  • ENSP00000371330
  • ENST00000381906
  • ENSP00000371331
  • ENST00000381911
  • ENSP00000371336

Symbol
  • DA2B
  • FSSV
  • fsTnI
  • AMCD2B
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
PubMedID
0.59
disease perturbation
0.56
cellular component
0.53
tissue sample
0.53
transcription factor
0.5


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 23.6   (req: < 5)
Gene RIFs: 13   (req: <= 3)
Antibodies: 403   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 23.6   (req: >= 5)
Gene RIFs: 13   (req: > 3)
Antibodies: 403   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (3)
Muscle contraction (R-HSA-397014)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 2 of 2
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Muscle contraction
Reactome
Striated Muscle Contraction
Name
Explore in Pharos
Explore in Source
Muscle contraction
Striated Muscle Contraction
Gene Ontology Terms (11)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (114)
1 – 10 of 114
NUCB2
Tbio
Novelty: 0.00828843
p_int: 0.999999991
p_ni: 9e-9
Score: 0.391
Data Source: BioPlex,STRINGDB
RFTN2
Tdark
Novelty: 1.69230769
p_int: 0.999802384
p_ni: 0.00019509
p_wrong: 0.000002525
Score: 0.214
Data Source: BioPlex,STRINGDB
KLHL21
Tbio
Novelty: 0.51282051
p_int: 0.999760359
p_ni: 0.000238169
p_wrong: 0.000001472
Score: 0.245
Data Source: BioPlex,STRINGDB
MECOM
Tbio
Family: TF; Epigenetic
Novelty: 0.00805252
p_int: 0.999711041
p_ni: 0.000010915
p_wrong: 0.000278044
Data Source: BioPlex
TLE4
Tbio
Novelty: 0.02737837
p_int: 0.995455479
p_ni: 0.004544521
Score: 0.188
Data Source: BioPlex,STRINGDB
TLE1
Tbio
Novelty: 0.00854022
p_int: 0.895772821
p_ni: 0.104227179
Score: 0.239
Data Source: BioPlex,STRINGDB
SIRT1
Tchem
Family: Epigenetic
Novelty: 0.00025951
p_int: 0.764885791
p_ni: 0.235114209
Score: 0.184
Data Source: BioPlex,STRINGDB
TNNC2
Tbio
Novelty: 0.11856592
Score: 0.999
Data Source: Reactome,STRINGDB
TNNC1
Tclin
Novelty: 0.06813757
Score: 0.999
Data Source: Reactome,STRINGDB
TNNT3
Tbio
Novelty: 0.0268478
Score: 0.999
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  23.60

PubMed score by year
PubTator Score  18.51

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGDEEKRNRAITARRQHLKSVMLQIAATELEKEESRREAEKQNYLAEHCPPLHIPGSMSEVQELCKQLHA
1-70
KIDAAEEEKYDMEVRVQKTSKELEDMNQKLFDLRGKFKRPPLRRVRMSADAMLKALLGSKHKVCMDLRAN
70-140
LKQVKKEDTEKERDLRDVGDWRKNIEEKSGMEGRKKMFESES
140-182
MGDEEKRNRAITARRQHLKSVMLQIAATELEKEESRREAEKQNYLAEHCPPLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKLFDLRGKFKRPPLRRVRMSADAMLKALLGSKHKVCMDLRANLKQVKKEDTEKERDLRDVGDWRKNIEEKSGMEGRKKMFESES