Protein Summary
Essential for the proper assembly of the glomerular and tubular basement membranes in kidney. (Microbial infection) Plays a role in human papillomavirus 16/HPV-16 endocytosis upon binding to cell surface receptor. The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It is involved in cellular processes including cell adhesion and may regulate integrin trafficking and/or function. This protein enhances cell motility, invasion and metastasis of cancer cells. Multiple alternatively spliced transcript variants that encode the same protein ...more
- ENST00000322008
- ENSP00000324101
- ENSG00000177697
- ENST00000397420
- ENSP00000380565
- ENST00000397421
- ENSP00000380566
- ENST00000530726
- ENSP00000432385
- TSPAN24
- GP27
- MER2
- RAPH
- SFA1
- PETA-3
- TSPAN24
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
---|---|---|---|
transcription factor perturbation | 0.88 | ||
tissue | 0.78 | ||
PubMedID | 0.76 | ||
biological term | 0.75 | ||
disease | 0.71 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 266.94 (req: < 5)
Gene RIFs: 103 (req: <= 3)
Antibodies: 607 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 266.94 (req: >= 5)
Gene RIFs: 103 (req: > 3)
Antibodies: 607 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 8
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligand: 0
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 0
Pathways (8)
Reactome (6)
PathwayCommons (1)
WikiPathways (1)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 5 of 6
Data Source | Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|---|
Reactome | Assembly of collagen fibrils and other multimeric structures | ||||
Reactome | Cell junction organization | ||||
Reactome | Cell-Cell communication | ||||
Reactome | Collagen formation | ||||
Reactome | Extracellular matrix organization | ||||
Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|
Assembly of collagen fibrils and other multimeric structures | ||||
Cell junction organization | ||||
Cell-Cell communication | ||||
Collagen formation | ||||
Extracellular matrix organization | ||||
Gene Ontology Terms (15)
Functions (1)
Components (7)
Processes (7)
Items per page:
10
1 – 1 of 1
GO Term | Evidence | Assigned by | ||
---|---|---|---|---|
Inferred from Direct Assay (IDA) | UniProtKB | |||
Protein-Protein Interactions (75)
1 – 10 of 75
ITGA6
Novelty: 0.00351957
p_int: 0.999922571
p_ni: 0.000077377
p_wrong: 5.3e-8
Score: 0.966
Data Source: BioPlex,Reactome,STRINGDB
ITGB2
Novelty: 0.00237551
p_int: 0.998628095
p_ni: 0.00079667
p_wrong: 0.000575236
Data Source: BioPlex
LRRC52
Family: IC
Novelty: 0.4058938
p_int: 0.895421423
p_ni: 0.007220608
p_wrong: 0.097357969
Data Source: BioPlex
TMPRSS11B
Family: Enzyme
Novelty: 1.71428571
p_int: 0.891104397
p_ni: 0.002720751
p_wrong: 0.106174853
Data Source: BioPlex
NCEH1
Family: Enzyme
Novelty: 0.02418747
p_int: 0.875548091
p_ni: 0.001198995
p_wrong: 0.123252914
Score: 0.188
Data Source: BioPlex,STRINGDB
ITGB4
Novelty: 0.00494012
Score: 0.964
Data Source: Reactome,STRINGDB
COL17A1
Novelty: 0.00158087
Score: 0.955
Data Source: Reactome,STRINGDB
PLEC
Novelty: 0.00291676
Score: 0.947
Data Source: Reactome,STRINGDB
DST
Novelty: 0.00153106
Score: 0.942
Data Source: Reactome,STRINGDB
LAMB3
Novelty: 0.00846457
Score: 0.912
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score 266.94
PubMed score by year
PubTator Score 193.45
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLATAYILVVAGTV
1-70
VMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHE
70-140
AVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCIT
140-210
KLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSLKLEHY
210-253
MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLATAYILVVAGTVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSLKLEHY
Find similar targets by: