You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CD151
CD151 antigen

Protein Summary
Description
Essential for the proper assembly of the glomerular and tubular basement membranes in kidney. (Microbial infection) Plays a role in human papillomavirus 16/HPV-16 endocytosis upon binding to cell surface receptor. The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It is involved in cellular processes including cell adhesion and may regulate integrin trafficking and/or function. This protein enhances cell motility, invasion and metastasis of cancer cells. Multiple alternatively spliced transcript variants that encode the same protein ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000322008
  • ENSP00000324101
  • ENSG00000177697
  • ENST00000397420
  • ENSP00000380565
  • ENST00000397421
  • ENSP00000380566
  • ENST00000530726
  • ENSP00000432385

Symbol
  • TSPAN24
  • GP27
  • MER2
  • RAPH
  • SFA1
  • PETA-3
  • TSPAN24
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.88
tissue
0.78
PubMedID
0.76
biological term
0.75
disease
0.71


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 266.94   (req: < 5)
Gene RIFs: 103   (req: <= 3)
Antibodies: 607   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 266.94   (req: >= 5)
Gene RIFs: 103   (req: > 3)
Antibodies: 607   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (8)
Assembly of collagen fibrils and other multimeric structures (R-HSA-2022090)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Assembly of collagen fibrils and other multimeric structures
Reactome
Cell junction organization
Reactome
Cell-Cell communication
Reactome
Collagen formation
Reactome
Extracellular matrix organization
Name
Explore in Pharos
Explore in Source
Assembly of collagen fibrils and other multimeric structures
Cell junction organization
Cell-Cell communication
Collagen formation
Extracellular matrix organization
Gene Ontology Terms (15)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Protein-Protein Interactions (75)
1 – 10 of 75
ITGA6
Tbio
Novelty: 0.00351957
p_int: 0.999922571
p_ni: 0.000077377
p_wrong: 5.3e-8
Score: 0.966
Data Source: BioPlex,Reactome,STRINGDB
ITGB2
Tclin
Novelty: 0.00237551
p_int: 0.998628095
p_ni: 0.00079667
p_wrong: 0.000575236
Data Source: BioPlex
LRRC52
Tbio
Family: IC
Novelty: 0.4058938
p_int: 0.895421423
p_ni: 0.007220608
p_wrong: 0.097357969
Data Source: BioPlex
TMPRSS11B
Tdark
Family: Enzyme
Novelty: 1.71428571
p_int: 0.891104397
p_ni: 0.002720751
p_wrong: 0.106174853
Data Source: BioPlex
NCEH1
Tchem
Family: Enzyme
Novelty: 0.02418747
p_int: 0.875548091
p_ni: 0.001198995
p_wrong: 0.123252914
Score: 0.188
Data Source: BioPlex,STRINGDB
ITGB4
Tbio
Novelty: 0.00494012
Score: 0.964
Data Source: Reactome,STRINGDB
COL17A1
Tbio
Novelty: 0.00158087
Score: 0.955
Data Source: Reactome,STRINGDB
PLEC
Tbio
Novelty: 0.00291676
Score: 0.947
Data Source: Reactome,STRINGDB
DST
Tbio
Novelty: 0.00153106
Score: 0.942
Data Source: Reactome,STRINGDB
LAMB3
Tbio
Novelty: 0.00846457
Score: 0.912
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  266.94

PubMed score by year
PubTator Score  193.45

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLATAYILVVAGTV
1-70
VMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHE
70-140
AVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCIT
140-210
KLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSLKLEHY
210-253
MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLATAYILVVAGTVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSLKLEHY