You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
ME1
NADP-dependent malic enzyme

Protein Summary
Description
This gene encodes a cytosolic, NADP-dependent enzyme that generates NADPH for fatty acid biosynthesis. The activity of this enzyme, the reversible oxidative decarboxylation of malate, links the glycolytic and citric acid cycles. The regulation of expression for this gene is complex. Increased expression can result from elevated levels of thyroid hormones or by higher proportions of carbohydrates in the diet. [provided by RefSeq, Jul 2008]
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.99
transcription factor perturbation
0.99
disease perturbation
0.93
kinase perturbation
0.88
histone modification site profile
0.87


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 110.7   (req: < 5)
Gene RIFs: 18   (req: <= 3)
Antibodies: 344   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 110.7   (req: >= 5)
Gene RIFs: 18   (req: > 3)
Antibodies: 344   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 18
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 3
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (19)
Metabolism (R-HSA-1430728)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism
Reactome
Metabolism of lipids
Reactome
PPARA activates gene expression
Reactome
Pyruvate metabolism
Reactome
Pyruvate metabolism and Citric Acid (TCA) cycle
Name
Explore in Pharos
Explore in Source
Metabolism
Metabolism of lipids
PPARA activates gene expression
Pyruvate metabolism
Pyruvate metabolism and Citric Acid (TCA) cycle
Gene Ontology Terms (20)
Items per page:
10
1 – 9 of 9
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Traceable Author Statement (TAS)
UniProtKB
Traceable Author Statement (TAS)
UniProtKB
Traceable Author Statement (TAS)
UniProtKB
Traceable Author Statement (TAS)
UniProtKB
Inferred from Electronic Annotation (IEA)
InterPro
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Protein-Protein Interactions (135)
1 – 10 of 135
FCF1
Tdark
Novelty: 0.00913312
p_int: 0.999616576
p_ni: 0.000383424
Data Source: BioPlex
VAC14
Tbio
Novelty: 0.03692957
p_int: 0.996389288
p_ni: 0.003610656
p_wrong: 5.6e-8
Data Source: BioPlex
ZSCAN12
Tdark
Family: TF
Novelty: 0.40909091
p_int: 0.989468049
p_ni: 0.010531824
p_wrong: 1.26e-7
Score: 0.161
Data Source: BioPlex,STRINGDB
CDK15
Tchem
Family: Kinase
Novelty: 3.88235294
p_int: 0.971945632
p_ni: 0.028052575
p_wrong: 0.000001793
Data Source: BioPlex
EFNB2
Tbio
Novelty: 0.00309066
p_int: 0.967652357
p_ni: 0.014713537
p_wrong: 0.017634107
Score: 0.158
Data Source: BioPlex,STRINGDB
FTH1
Tbio
Novelty: 0.00088724
p_int: 0.957053238
p_ni: 0.042822501
p_wrong: 0.000124262
Score: 0.218
Data Source: BioPlex,STRINGDB
OAZ3
Tbio
Family: Enzyme
Novelty: 0.04752744
p_int: 0.930849443
p_ni: 0.069027946
p_wrong: 0.000122611
Data Source: BioPlex
NPPA
Tchem
Novelty: 0.00054421
p_int: 0.918309597
p_ni: 0.081446998
p_wrong: 0.000243404
Data Source: BioPlex
LYPD4
Tbio
Novelty: 0.00522455
p_int: 0.89447287
p_ni: 0.105380529
p_wrong: 0.000146601
Data Source: BioPlex
KLHL11
Tdark
Novelty: 0.39728266
p_int: 0.876573281
p_ni: 0.123426715
p_wrong: 4e-9
Data Source: BioPlex
Publication Statistics
PubMed Score  110.70

PubMed score by year
PubTator Score  835.81

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEPEAPRRRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFD
1-70
RYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKPRGLFITIHDRGHIASVLNAW
70-140
PEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECLPVILDVGTENEELLKDPLYIG
140-210
LRQRRVRGSEYDDFLDEFMEAVSSKYGMNCLIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAG
210-280
LLAALRITKNKLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQE
280-350
KEKFAHEHEEMKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQC
350-420
YKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLTTAEVIAQQVS
420-490
DKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRSQMYSTDYDQILPDCYSWP
490-560
EEVQKIQTKVDQ
560-572
MEPEAPRRRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKPRGLFITIHDRGHIASVLNAWPEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECLPVILDVGTENEELLKDPLYIGLRQRRVRGSEYDDFLDEFMEAVSSKYGMNCLIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEEMKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRSQMYSTDYDQILPDCYSWPEEVQKIQTKVDQ