You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GLIPR1
Glioma pathogenesis-related protein 1

Protein Summary
Description
This gene encodes a protein with similarity to both the pathogenesis-related protein (PR) superfamily and the cysteine-rich secretory protein (CRISP) family. Increased expression of this gene is associated with myelomocytic differentiation in macrophage and decreased expression of this gene through gene methylation is associated with prostate cancer. The protein has proapoptotic activities in prostate and bladder cancer cells. This gene is a member of a cluster on chromosome 12 containing two other similar genes. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000266659
  • ENSP00000266659
  • ENSG00000139278

Symbol
  • GLIPR
  • RTVP1
  • GLIPR
  • RTVP1
  • CRISP7
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.88
PubMedID
0.84
disease perturbation
0.83
small molecule perturbation
0.82
kinase perturbation
0.81


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 34.02   (req: < 5)
Gene RIFs: 24   (req: <= 3)
Antibodies: 145   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 34.02   (req: >= 5)
Gene RIFs: 24   (req: > 3)
Antibodies: 145   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (7)
Immune System (R-HSA-168256)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Immune System
Reactome
Innate Immune System
Reactome
Metabolism
Reactome
Metabolism of lipids
Reactome
Neutrophil degranulation
Name
Explore in Pharos
Explore in Source
Immune System
Innate Immune System
Metabolism
Metabolism of lipids
Neutrophil degranulation
Protein-Protein Interactions (114)
1 – 10 of 114
ALOXE3
Tbio
Family: Enzyme
Novelty: 0.03319677
p_int: 0.849743824
p_ni: 0.150255898
p_wrong: 2.78e-7
Score: 0.261
Data Source: BioPlex,STRINGDB
CMTM6
Tbio
Novelty: 0.15594208
Score: 0.924
Data Source: STRINGDB
HELZ2
Tdark
Family: Enzyme
Novelty: 0.28753695
Score: 0.913
Data Source: STRINGDB
LAMP1
Tbio
Novelty: 0.00104159
Score: 0.909
Data Source: STRINGDB
CD63
Tchem
Novelty: 0.00112133
Score: 0.908
Data Source: STRINGDB
C3AR1
Tchem
Family: GPCR
Novelty: 0.00700844
Score: 0.908
Data Source: STRINGDB
NCOA1
Tchem
Family: Epigenetic
Novelty: 0.00427551
Score: 0.905
Data Source: STRINGDB
VNN1
Tchem
Family: Enzyme
Novelty: 0.01845634
Score: 0.905
Data Source: STRINGDB
RAP1B
Tbio
Family: Enzyme
Novelty: 0.00195699
Score: 0.905
Data Source: STRINGDB
CD68
Tbio
Novelty: 0.00026143
Score: 0.904
Data Source: STRINGDB
Publication Statistics
PubMed Score  34.02

PubMed score by year
PubTator Score  31.19

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRVTLATIAWMVSFVSNYSHTANILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKA
1-70
WASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQ
70-140
VVWADSYKVGCAVQFCPKVSGFDALSNGAHFICNYGPGGNYPTWPYKRGATCSACPNNDKCLDNLCVNRQ
140-210
RDQVKRYYSVVYPGWPIYPRNRYTSLFLIVNSVILILSVIITILVQHKYPNLVLLD
210-266
MRVTLATIAWMVSFVSNYSHTANILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQVVWADSYKVGCAVQFCPKVSGFDALSNGAHFICNYGPGGNYPTWPYKRGATCSACPNNDKCLDNLCVNRQRDQVKRYYSVVYPGWPIYPRNRYTSLFLIVNSVILILSVIITILVQHKYPNLVLLD