You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
XCL1
Lymphotactin

Protein Summary
Description
Chemotactic activity for lymphocytes but not for monocytes or neutrophils. In thymus, mediates medullary accumulation of thymic dendritic cells and contributes to regulatoy T cell development, playing a role in self-tolerance establishment. This antimicrobial gene encodes a member of the chemokine superfamily. Chemokines function in inflammatory and immunological responses, inducing leukocyte migration and activation. The encoded protein is a member of the C-chemokine subfamily, retaining only two of four cysteines conserved in other chemokines, and is thought to be specifically chemotactic for T cells. This gene and a closely related family member are located on the long arm of chromosome 1. [provided by RefSeq, Sep 2014]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000367818
  • ENSP00000356792
  • ENSG00000143184

Symbol
  • LTN
  • SCYC1
  • LTN
  • ATAC
  • LPTN
  • SCM1
  • SCM-1
  • SCM1A
  • SCYC1
  • SCM-1a
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
gene perturbation
0.75
tissue sample
0.72
kinase perturbation
0.6
microRNA
0.55


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 351.07   (req: < 5)
Gene RIFs: 26   (req: <= 3)
Antibodies: 368   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 351.07   (req: >= 5)
Gene RIFs: 26   (req: > 3)
Antibodies: 368   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 51
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (6)
1 – 5 of 6
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (12)
Chemokine receptors bind chemokines (R-HSA-380108)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Chemokine receptors bind chemokines
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
G alpha (q) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Name
Explore in Pharos
Explore in Source
Chemokine receptors bind chemokines
Class A/1 (Rhodopsin-like receptors)
G alpha (q) signalling events
GPCR downstream signalling
GPCR ligand binding
Protein-Protein Interactions (255)
1 – 10 of 255
FAT4
Tbio
Novelty: 0.01665267
p_int: 0.998515394
p_ni: 0.001484606
Score: 0.169
Data Source: BioPlex,STRINGDB
TUBB8
Tclin
Novelty: 0.11569363
p_int: 0.970244491
p_ni: 0.029755509
Data Source: BioPlex
TUBB3
Tclin
Novelty: 0.00281462
p_int: 0.966784159
p_ni: 0.033215841
Data Source: BioPlex
FAT3
Tbio
Novelty: 0.02603864
p_int: 0.884573965
p_ni: 0.115426035
Score: 0.165
Data Source: BioPlex,STRINGDB
COL6A2
Tbio
Novelty: 0.01825304
p_int: 0.803892178
p_ni: 0.196107822
Score: 0.177
Data Source: BioPlex,STRINGDB
ADGRV1
Tbio
Family: GPCR
Novelty: 0.00291831
p_int: 0.788816647
p_ni: 0.211183353
Score: 0.165
Data Source: BioPlex,STRINGDB
FSTL1
Tbio
Novelty: 0.00842838
p_int: 0.763242438
p_ni: 0.228396289
p_wrong: 0.008361273
Score: 0.189
Data Source: BioPlex,STRINGDB
XCR1
Tbio
Family: GPCR
Novelty: 0.01497998
Score: 0.996
Data Source: Reactome,STRINGDB
XCL2
Tbio
Novelty: 0.072835
Score: 0.954
Data Source: STRINGDB
P2RY10
Tchem
Family: GPCR
Novelty: 0.30443923
Score: 0.92
Data Source: STRINGDB
Publication Statistics
PubMed Score  351.07

PubMed score by year
PubTator Score  134.56

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRLLILALLGICSLTAYIVEGVGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCA
1-70
DPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
70-114
MRLLILALLGICSLTAYIVEGVGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG