You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ZFP36L2
mRNA decay activator protein ZFP36L2

Protein Summary
Description
Zinc-finger RNA-binding protein that destabilizes several cytoplasmic AU-rich element (ARE)-containing mRNA transcripts by promoting their poly(A) tail removal or deadenylation, and hence provide a mechanism for attenuating protein synthesis (PubMed:25106868, PubMed:14981510). Acts as a 3'-untranslated region (UTR) ARE mRNA-binding adapter protein to communicate signaling events to the mRNA decay machinery (PubMed:25106868). Functions by recruiting the CCR4-NOT deadenylase complex and probably other components of the cytoplasmic RNA decay machinery to the bound ARE-containing mRNAs, and hence promotes ARE-mediated mRNA deadenylation and decay processes (PubMed:25106868). Binds to 3'-UTR ARE of numerous mRNAs (PubMed:20506496, PubMed:25106868, PubMed:14981510). Promotes ARE-containing mRNA decay of the low-density lipoprotein (LDL) receptor (LDLR) mRNA in response to phorbol 12-myristate 13-acetate (PMA) treatment in a p38 MAPK-dependent manner (PubMed:25106868). Positively regulates ea ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000282388
  • ENSP00000282388
  • ENSG00000152518

Symbol
  • BRF2
  • ERF2
  • RNF162C
  • TIS11D
  • BRF2
  • ERF2
  • ERF-2
  • TIS11D
  • RNF162C
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.99
transcription factor binding site profile
0.98
small molecule perturbation
0.97
PubMedID
0.92
microRNA
0.81


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 39.42   (req: < 5)
Gene RIFs: 10   (req: <= 3)
Antibodies: 211   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 39.42   (req: >= 5)
Gene RIFs: 10   (req: > 3)
Antibodies: 211   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 31
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (34)
Items per page:
10
1 – 8 of 8
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence Model (ISM)
NTNU_SB
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (26)
1 – 10 of 26
HIF1AN
Tbio
Novelty: 0.01079184
p_int: 0.94650483
p_ni: 3.63e-7
p_wrong: 0.053494807
Score: 0.235
Data Source: BioPlex,STRINGDB
LAD1
Tbio
Novelty: 0.03138033
p_int: 0.917983196
p_ni: 0.000137007
p_wrong: 0.081879797
Score: 0.212
Data Source: BioPlex,STRINGDB
GOLGA7
Tbio
Novelty: 0.42056075
Score: 0.904
Data Source: STRINGDB
ZDHHC9
Tbio
Family: Enzyme
Novelty: 0.07515658
Score: 0.902
Data Source: STRINGDB
ZFP36L1
Tbio
Novelty: 0.0264538
Score: 0.829
Data Source: STRINGDB
MAPKAPK2
Tchem
Family: Kinase
Novelty: 0.00521234
Score: 0.816
Data Source: STRINGDB
ZDHHC4
Tdark
Family: Enzyme
Novelty: 0.01603139
Score: 0.574
Data Source: STRINGDB
CNOT1
Tbio
Novelty: 0.00726919
Score: 0.57
Data Source: STRINGDB
MBNL1
Tbio
Novelty: 0.00455774
Score: 0.557
Data Source: STRINGDB
BRF1
Tbio
Novelty: 0.00510161
Score: 0.541
Data Source: STRINGDB
Publication Statistics
PubMed Score  39.42

PubMed score by year
PubTator Score  28.01

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSTTLLSAFYDVDFLCKTEKSLANLNLNNMLDKKAVGTPVAAAPSSGFAPGFLRRHSASNLHALAHPAPS
1-70
PGSCSPKFPGAANGSSCGSAAAGGPTSYGTLKEPSGGGGTALLNKENKFRDRSFSENGDRSQHLLHLQQQ
70-140
QKGGGGSQINSTRYKTELCRPFEESGTCKYGEKCQFAHGFHELRSLTRHPKYKTELCRTFHTIGFCPYGP
140-210
RCHFIHNADERRPAPSGGASGDLRAFGTRDALHLGFPREPRPKLHHSLSFSGFPSGHHQPPGGLESPLLL
210-280
DSPTSRTPPPPSCSSASSCSSSASSCSSASAASTPSGAPTCCASAAAAAAAALLYGTGGAEDLLAPGAPC
280-350
AACSSASCANNAFAFGPELSSLITPLAIQTHNFAAVAAAAYYRSQQQQQQQGLAPPAQPPAPPSATLPAG
350-420
AAAPPSPPFSFQLPRRLSDSPVFDAPPSPPDSLSDRDSYLSGSLSSGSLSGSESPSLDPGRRLPIFSRLS
420-490
ISDD
490-494
MSTTLLSAFYDVDFLCKTEKSLANLNLNNMLDKKAVGTPVAAAPSSGFAPGFLRRHSASNLHALAHPAPSPGSCSPKFPGAANGSSCGSAAAGGPTSYGTLKEPSGGGGTALLNKENKFRDRSFSENGDRSQHLLHLQQQQKGGGGSQINSTRYKTELCRPFEESGTCKYGEKCQFAHGFHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNADERRPAPSGGASGDLRAFGTRDALHLGFPREPRPKLHHSLSFSGFPSGHHQPPGGLESPLLLDSPTSRTPPPPSCSSASSCSSSASSCSSASAASTPSGAPTCCASAAAAAAAALLYGTGGAEDLLAPGAPCAACSSASCANNAFAFGPELSSLITPLAIQTHNFAAVAAAAYYRSQQQQQQQGLAPPAQPPAPPSATLPAGAAAPPSPPFSFQLPRRLSDSPVFDAPPSPPDSLSDRDSYLSGSLSSGSLSGSESPSLDPGRRLPIFSRLSISDD