You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
HTR5A
5-hydroxytryptamine receptor 5A

Protein Summary
Description
This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins. The neurotransmitter serotonin (5-hydroxytryptamine, 5-HT) has been implicated in a wide range of psychiatric conditions and also has vasoconstrictive and vasodilatory effects. The gene described in this record is a member of 5-hydroxytryptamine (serotonin) receptor family and encodes a multi-pass membrane protein that functions as a receptor for 5-hydroxytryptamine and couples to G-proteins. This protein has been shown to function in part through the regulation of intracellular Ca2+ mobilization. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000287907
  • ENSP00000287907
  • ENSG00000157219
  • ENST00000650536
  • ENSP00000497571

Symbol
  • 5-HT5A
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
ligand (chemical)
0.8
gene perturbation
0.59
protein domain
0.58
cell type or tissue
0.52
cellular component
0.52


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 51.15   (req: < 5)
Gene RIFs: 14   (req: <= 3)
Antibodies: 329   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 51.15   (req: >= 5)
Gene RIFs: 14   (req: > 3)
Antibodies: 329   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 11
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 106
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 9
Pathways (14)
Amine ligand-binding receptors (R-HSA-375280)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Amine ligand-binding receptors
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
G alpha (i) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Name
Explore in Pharos
Explore in Source
Amine ligand-binding receptors
Class A/1 (Rhodopsin-like receptors)
G alpha (i) signalling events
GPCR downstream signalling
GPCR ligand binding
Protein-Protein Interactions (423)
1 – 10 of 423
GPR37
Tbio
Family: GPCR
Novelty: 0.02427642
Score: 0.969
Data Source: STRINGDB
MCHR1
Tchem
Family: GPCR
Novelty: 0.00335291
Score: 0.955
Data Source: STRINGDB
GABBR2
Tclin
Family: GPCR
Novelty: 0.0106043
Score: 0.95
Data Source: STRINGDB
OXGR1
Tchem
Family: GPCR
Novelty: 0.04019734
Score: 0.948
Data Source: STRINGDB
HRH3
Tclin
Family: GPCR
Novelty: 0.00180244
Score: 0.947
Data Source: STRINGDB
HTR1E
Tchem
Family: GPCR
Novelty: 0.02388691
Score: 0.945
Data Source: STRINGDB
GRM3
Tchem
Family: GPCR
Novelty: 0.00438401
Score: 0.943
Data Source: STRINGDB
GNG3
Tbio
Novelty: 0.16248863
Score: 0.942
Data Source: STRINGDB
HTR1A
Tclin
Family: GPCR
Novelty: 0.00019966
Score: 0.941
Data Source: STRINGDB
GNG13
Tbio
Novelty: 0.14784205
Score: 0.941
Data Source: STRINGDB
Publication Statistics
PubMed Score  51.15

PubMed score by year
PubTator Score  75.86

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLLVLATILRVRT
1-70
FHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIACDVLCCTASIWNVTAIALDRY
70-140
WSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFGWGETYSEGSEECQVSREPSYAVFSTVGAFY
140-210
LPLCVVLFVYWKIYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKE
210-280
QRAALMVGILIGVFVLCWIPFFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFK
280-350
NFFSRQH
350-357
MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLLVLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIACDVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFGWGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIPFFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH