You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
HTR3A
5-hydroxytryptamine receptor 3A

Protein Summary
Description
This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses in neurons. It is a cation-specific, but otherwise relatively nonselective, ion channel. The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes subunit A of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. It appears that the heteromeric combination of A and B subunits is necessary to provide the full functional features of this receptor, since either subunit alone results in receptors with very low conductance and response amplitude. Alternatively spliced transcript variants encoding different isoforms ha ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000299961
  • ENSP00000299961
  • ENSG00000166736
  • ENST00000355556
  • ENSP00000347754
  • ENST00000375498
  • ENSP00000364648
  • ENST00000504030
  • ENSP00000424189
  • ENST00000506841
  • ENSP00000424776

Symbol
  • 5HT3R
  • HTR3
  • HTR3
  • 5HT3R
  • 5-HT-3
  • 5-HT3A
  • 5-HT3R
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
1
drug
0.92
protein domain
0.92
disease
0.87
phenotype
0.85


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2783.16   (req: < 5)
Gene RIFs: 96   (req: <= 3)
Antibodies: 379   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2783.16   (req: >= 5)
Gene RIFs: 96   (req: > 3)
Antibodies: 379   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 12
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 588
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 19
Pathways (6)
Neuronal System (R-HSA-112316)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Neuronal System
Reactome
Neurotransmitter receptors and postsynaptic signal transmission
Reactome
Transmission across Chemical Synapses
Name
Explore in Pharos
Explore in Source
Neuronal System
Neurotransmitter receptors and postsynaptic signal transmission
Transmission across Chemical Synapses
Protein-Protein Interactions (245)
1 – 10 of 245
OCA2
Tbio
Novelty: 0.00300697
p_int: 0.999998577
p_ni: 0.00000123
p_wrong: 1.93e-7
Score: 0.186
Data Source: BioPlex,STRINGDB
HLA-DOA
Tbio
Novelty: 0.01350393
p_int: 0.999998446
p_ni: 0.000001394
p_wrong: 1.6e-7
Score: 0.186
Data Source: BioPlex,STRINGDB
ABCA7
Tbio
Family: Transporter
Novelty: 0.00568072
p_int: 0.999994347
p_ni: 0.000005586
p_wrong: 6.7e-8
Score: 0.194
Data Source: BioPlex,STRINGDB
UGT3A2
Tbio
Family: Enzyme
Novelty: 1.37837838
p_int: 0.999981771
p_ni: 0.000018096
p_wrong: 1.33e-7
Score: 0.153
Data Source: BioPlex,STRINGDB
LRRC8D
Tbio
Novelty: 0.19392074
p_int: 0.999977424
p_ni: 0.000022561
p_wrong: 1.5e-8
Data Source: BioPlex
SLC41A3
Tdark
Family: Transporter
Novelty: 0.41679823
p_int: 0.999932622
p_ni: 0.000026952
p_wrong: 0.000040426
Data Source: BioPlex
PANX1
Tbio
Family: IC
Novelty: 0.00209499
p_int: 0.999928551
p_ni: 0.000059599
p_wrong: 0.00001185
Score: 0.241
Data Source: BioPlex,STRINGDB
PLPPR3
Tbio
Family: Enzyme
Novelty: 0.07644355
p_int: 0.999909391
p_ni: 0.000049315
p_wrong: 0.000041294
Data Source: BioPlex
MARCH6
Tbio
Family: Enzyme
Novelty: 0.01959449
p_int: 0.999786532
p_ni: 0.000184249
p_wrong: 0.000029219
Data Source: BioPlex
TUSC3
Tbio
Novelty: 0.01081706
p_int: 0.99974142
p_ni: 0.000258297
p_wrong: 2.84e-7
Data Source: BioPlex
Publication Statistics
PubMed Score  2783.16

PubMed score by year
PubTator Score  285.19

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MLLWVQQALLALLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTTVSIDVIVYAI
1-70
LNVDEKNQVLTTYIWYRQYWTDEFLQWNPEDFDNITKLSIPTDSIWVPDILINEFVDVGKSPNIPYVYIR
70-140
HQGEVQNYKPLQVVTACSLDIYNFPFDVQNCSLTFTSWLHTIQDINISLWRLPEKVKSDRSVFMNQGEWE
140-210
LLGVLPYFREFSMESSNYYAEMKFYVVIRRRPLFYVVSLLLPSIFLMVMDIVGFYLPPNSGERVSFKITL
210-280
LLGYSVFLIIVSDTLPATAIGTPLIGVYFVVCMALLVISLAETIFIVRLVHKQDLQQPVPAWLRHLVLER
280-350
IAWLLCLREQSTSQRPPATSQATKTDDCSAMGNHCSHMGGPQDFEKSPRDRCSPPPPPREASLAVCGLLQ
350-420
ELSSIRQFLEKRDEIREVARDWLRVGSVLDKLLFHIYLLAVLAYSITLVMLWSIWQYA
420-478
MLLWVQQALLALLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTTVSIDVIVYAILNVDEKNQVLTTYIWYRQYWTDEFLQWNPEDFDNITKLSIPTDSIWVPDILINEFVDVGKSPNIPYVYIRHQGEVQNYKPLQVVTACSLDIYNFPFDVQNCSLTFTSWLHTIQDINISLWRLPEKVKSDRSVFMNQGEWELLGVLPYFREFSMESSNYYAEMKFYVVIRRRPLFYVVSLLLPSIFLMVMDIVGFYLPPNSGERVSFKITLLLGYSVFLIIVSDTLPATAIGTPLIGVYFVVCMALLVISLAETIFIVRLVHKQDLQQPVPAWLRHLVLERIAWLLCLREQSTSQRPPATSQATKTDDCSAMGNHCSHMGGPQDFEKSPRDRCSPPPPPREASLAVCGLLQELSSIRQFLEKRDEIREVARDWLRVGSVLDKLLFHIYLLAVLAYSITLVMLWSIWQYA