You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
MMP13
Collagenase 3

Protein Classes
Protein Summary
Description
Plays a role in the degradation of extracellular matrix proteins including fibrillar collagen, fibronectin, TNC and ACAN. Cleaves triple helical collagens, including type I, type II and type III collagen, but has the highest activity with soluble type II collagen. Can also degrade collagen type IV, type XIV and type X. May also function by activating or degrading key regulatory proteins, such as TGFB1 and CTGF. Plays a role in wound healing, tissue remodeling, cartilage degradation, bone development, bone mineralization and ossification. Required for normal embryonic bone development and ossification. Plays a role in the healing of bone fractures via endochondral ossification. Plays a role in wound healing, probably by a mechanism that involves proteolytic activation of TGFB1 and degradation of CTGF. Plays a role in keratinocyte migration during wound healing. May play a role in cell migration and in tumor cell invasion. This gene encodes a member of the peptidase M10 family of matrix ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000260302
  • ENSP00000260302
  • ENSG00000137745

Symbol
  • CLG3
  • MDST
  • MANDP1
  • MMP-13
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
1
biological term
0.98
gene perturbation
0.85
chemical
0.82
disease
0.76


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1361.96   (req: < 5)
Gene RIFs: 259   (req: <= 3)
Antibodies: 971   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1361.96   (req: >= 5)
Gene RIFs: 259   (req: > 3)
Antibodies: 971   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 2045
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (48)
1 – 5 of 48
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (68)
Activation of Matrix Metalloproteinases (R-HSA-1592389)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 11
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activation of Matrix Metalloproteinases
Reactome
Assembly of collagen fibrils and other multimeric structures
Reactome
Collagen degradation
Reactome
Collagen formation
Reactome
Degradation of the extracellular matrix
Name
Explore in Pharos
Explore in Source
Activation of Matrix Metalloproteinases
Assembly of collagen fibrils and other multimeric structures
Collagen degradation
Collagen formation
Degradation of the extracellular matrix
Protein-Protein Interactions (199)
1 – 10 of 199
MYCBP2
Tbio
Family: Enzyme
Novelty: 0.00336142
p_int: 0.999985544
p_ni: 0.000014456
Data Source: BioPlex
FBXO45
Tbio
Novelty: 0.08978487
p_int: 0.999706516
p_ni: 0.000283778
p_wrong: 0.000009706
Data Source: BioPlex
PEAK1
Tbio
Family: Kinase
Novelty: 0.00254215
p_int: 0.997177393
p_ni: 0.002822606
p_wrong: 1e-9
Data Source: BioPlex
SPRYD3
Tdark
p_int: 0.991992985
p_ni: 0.000021102
p_wrong: 0.007985913
Data Source: BioPlex
HTRA2
Tbio
Family: Enzyme
Novelty: 0.00078515
p_int: 0.991298641
p_ni: 0.008701359
Data Source: BioPlex
GID4
Tbio
Novelty: 0.10469899
p_int: 0.983636686
p_ni: 0.016363314
Data Source: BioPlex
ARMC8
Tbio
Novelty: 0.08450354
p_int: 0.982847074
p_ni: 0.017152926
Data Source: BioPlex
WDR26
Tbio
Novelty: 0.07848267
p_int: 0.982235842
p_ni: 0.017764159
Data Source: BioPlex
ADAMTS2
Tbio
Family: Enzyme
Novelty: 0.00060547
p_int: 0.945194648
p_ni: 0.054542912
p_wrong: 0.00026244
Score: 0.362
Data Source: BioPlex,STRINGDB
MKLN1
Tbio
Novelty: 0.07307009
p_int: 0.944621862
p_ni: 0.055378138
Data Source: BioPlex
Publication Statistics
PubMed Score  1361.96

PubMed score by year
PubTator Score  1057.39

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENAASSMTERLRE
1-70
MQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKK
70-140
AFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSS
140-210
SKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKT
210-280
PDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFR
280-350
GRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLI
350-420
EEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
420-471
MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENAASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC