You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
KIR3DL1
Killer cell immunoglobulin-like receptor 3DL1

Protein Classes
Protein Summary
Description
Receptor on natural killer (NK) cells for HLA Bw4 allele. Inhibits the activity of NK cells thus preventing cell lysis. Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies among haplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000358178
  • ENSP00000350901
  • ENSG00000167633
  • ENST00000391728
  • ENSP00000375608
  • ENST00000612668
  • ENSP00000484488
  • ENSG00000274036
  • ENST00000616188
  • ENSP00000484036
  • ENSG00000275288
  • ENST00000621353
  • ENSP00000484972
  • ENSG00000276423
  • ENST00000639353
  • ENSP00000492794
  • ENSG00000284342
  • ENST00000639813
  • ENSP00000492173
  • ENSG00000284426
  • ENST00000640111
  • ENSP00000491437
  • ENST00000640788
  • ENSP00000491550

Symbol
  • CD158E
  • NKAT3
  • NKB1
  • KIR
  • NKB1
  • NKAT3
  • NKB1B
  • NKAT-3
  • CD158E1
  • KIR3DL1/S1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase
0.84
cell line
0.73
biological term
0.59
cell type or tissue
0.58
disease
0.54


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 451.9   (req: < 5)
Gene RIFs: 119   (req: <= 3)
Antibodies: 514   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 451.9   (req: >= 5)
Gene RIFs: 119   (req: > 3)
Antibodies: 514   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (6)
1 – 5 of 6
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (7)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Immune System
Reactome
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Immune System
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Protein-Protein Interactions (150)
1 – 10 of 150
KIR3DS1
Tdark
p_int: 0.999999994
p_ni: 1e-9
p_wrong: 5e-9
Data Source: BioPlex
KIR2DL1
Tbio
Novelty: 0.00334448
p_int: 0.999999979
p_ni: 1.7e-8
p_wrong: 3e-9
Score: 0.864
Data Source: BioPlex,STRINGDB
KIR2DS2
Tdark
p_int: 0.999999948
p_ni: 8e-9
p_wrong: 4.4e-8
Data Source: BioPlex
FAM114A2
Tdark
Novelty: 0.75
p_int: 0.957632593
p_ni: 0.036894213
p_wrong: 0.005473193
Data Source: BioPlex
HLA-B
Tbio
Novelty: 0.01289492
Score: 0.992
Data Source: STRINGDB
HLA-B
Tbio
Novelty: 0.01289492
Score: 0.992
Data Source: STRINGDB
HLA-B
Tbio
Novelty: 0.01289492
Score: 0.992
Data Source: STRINGDB
HLA-B
Tbio
Novelty: 0.01289492
Score: 0.992
Data Source: STRINGDB
HLA-B
Tbio
Novelty: 0.01289492
Score: 0.992
Data Source: STRINGDB
HLA-B
Tbio
Novelty: 0.01289492
Score: 0.992
Data Source: STRINGDB
Publication Statistics
PubMed Score  451.90

PubMed score by year
PubTator Score  183.11

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSLMVVSMACVGLFLVQRAGPHMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHIPI
1-70
FHGRIFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERV
70-140
ILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPS
140-210
DPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADF
210-280
PLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLHILIGTSVVII
280-350
LFILLLFFLLHLWCSNKKNAAVMDQEPAGNRTANSEDSDEQDPEEVTYAQLDHCVFTQRKITRPSQRPKT
350-420
PPTDTILYTELPNAKPRSKVVSCP
420-444
MSLMVVSMACVGLFLVQRAGPHMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHIPIFHGRIFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLHILIGTSVVIILFILLLFFLLHLWCSNKKNAAVMDQEPAGNRTANSEDSDEQDPEEVTYAQLDHCVFTQRKITRPSQRPKTPPTDTILYTELPNAKPRSKVVSCP