You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MAGEA11
Melanoma-associated antigen 11

Protein Summary
Description
Acts as androgen receptor coregulator that increases androgen receptor activity by modulating the receptors interdomain interaction. May play a role in embryonal development and tumor transformation or aspects of tumor progression. This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000355220
  • ENSP00000347358
  • ENSG00000185247

Symbol
  • MAGE11
  • CT1.11
  • MAGE11
  • MAGE-11
  • MAGEA-11
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.9
gene perturbation
0.63
tissue
0.55
transcription factor
0.46
biological term
0.42


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 23.94   (req: < 5)
Gene RIFs: 21   (req: <= 3)
Antibodies: 211   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 23.94   (req: >= 5)
Gene RIFs: 21   (req: > 3)
Antibodies: 211   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (3)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
HPA
Inferred from Direct Assay (IDA)
HPA
Inferred from Direct Assay (IDA)
HPA
Protein-Protein Interactions (34)
1 – 10 of 34
AR
Tclin
Family: NR
Novelty: 0.00013834
Score: 0.713
Data Source: STRINGDB
EGLN1
Tclin
Novelty: 0.00280193
Score: 0.679
Data Source: STRINGDB
NCOA2
Tbio
Novelty: 0.00643607
Score: 0.657
Data Source: STRINGDB
TRMT1
Tbio
Family: Enzyme
Novelty: 0.02248454
Score: 0.65
Data Source: STRINGDB
EP300
Tchem
Family: Epigenetic
Novelty: 0.00060382
Score: 0.646
Data Source: STRINGDB
CSAG1
Tdark
Novelty: 0.32876712
Score: 0.627
Data Source: STRINGDB
MAGEA6
Tbio
Novelty: 0.0600948
Score: 0.577
Data Source: STRINGDB
RNF14
Tbio
Family: Enzyme
Novelty: 0.07462325
Score: 0.552
Data Source: STRINGDB
USHBP1
Tbio
Novelty: 0.13289037
Score: 0.551
Data Source: STRINGDB
ZMAT4
Tdark
Novelty: 0.54794521
Score: 0.551
Data Source: STRINGDB
Publication Statistics
PubMed Score  23.94

PubMed score by year
PubTator Score  48.91

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
METQFRRGGLGCSPASIKRKKKREDSGDFGLQVSTMFSEDDFQSTERAPYGPQLQWSQDLPRVQVFREQA
1-70
NLEDRSPRRTQRITGGEQVLWGPITQIFPTVRPADLTRVIMPLEQRSQHCKPEEGLQAQEEDLGLVGAQA
70-140
LQAEEQEAAFFSSTLNVGTLEELPAAESPSPPQSPQEESFSPTAMDAIFGSLSDEGSGSQEKEGPSTSPD
140-210
LIDPESFSQDILHDKIIDLVHLLLRKYRVKGLITKAEMLGSVIKNYEDYFPEIFREASVCMQLLFGIDVK
210-280
EVDPTSHSYVLVTSLNLSYDGIQCNEQSMPKSGLLIIVLGVIFMEGNCIPEEVMWEVLSIMGVYAGREHF
280-350
LFGEPKRLLTQNWVQEKYLVYRQVPGTDPACYEFLWGPRAHAETSKMKVLEYIANANGRDPTSYPSLYED
350-420
ALREEGEGV
420-429
METQFRRGGLGCSPASIKRKKKREDSGDFGLQVSTMFSEDDFQSTERAPYGPQLQWSQDLPRVQVFREQANLEDRSPRRTQRITGGEQVLWGPITQIFPTVRPADLTRVIMPLEQRSQHCKPEEGLQAQEEDLGLVGAQALQAEEQEAAFFSSTLNVGTLEELPAAESPSPPQSPQEESFSPTAMDAIFGSLSDEGSGSQEKEGPSTSPDLIDPESFSQDILHDKIIDLVHLLLRKYRVKGLITKAEMLGSVIKNYEDYFPEIFREASVCMQLLFGIDVKEVDPTSHSYVLVTSLNLSYDGIQCNEQSMPKSGLLIIVLGVIFMEGNCIPEEVMWEVLSIMGVYAGREHFLFGEPKRLLTQNWVQEKYLVYRQVPGTDPACYEFLWGPRAHAETSKMKVLEYIANANGRDPTSYPSLYEDALREEGEGV