You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
MAGEA5
Melanoma-associated antigen 5

Protein Summary
Description
Not known, though may play a role tumor transformation or progression. In vitro promotes cell viability in melanoma cell lines. This locus represents naturally occurring read-through transcription between the neighboring MAGEA10 (melanoma antigen family A, 10) and MAGEA5 (melanoma antigen family A, 5) genes on chromosome X. The read-through transcript is predicted to encode the downstream gene product. [provided by RefSeq, Mar 2011]
Uniprot Accession IDs
Gene Name
Symbol
  • MAGE5
  • CT1.5
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
tissue
0.65
tissue sample
0.55
microRNA
0.54
cellular component
0.52
cell type or tissue
0.5


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 0   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 0   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 1
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Publication Statistics
PubTator Score  1.7

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSLEQKSQHCKPEEGLDTQEEALGLVGVQAATTEEQEAVSSSSPLVPGTLGEVPAAGSPGPLKSPQGASA
1-70
IPTAIDFTLWRQSIKGSSNQEEEGPSTSPDPESVFRAALSKKVADLIHFLLLKY
70-124
MSLEQKSQHCKPEEGLDTQEEALGLVGVQAATTEEQEAVSSSSPLVPGTLGEVPAAGSPGPLKSPQGASAIPTAIDFTLWRQSIKGSSNQEEEGPSTSPDPESVFRAALSKKVADLIHFLLLKY