You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MCAM
Cell surface glycoprotein MUC18

Protein Summary
Description
Plays a role in cell adhesion, and in cohesion of the endothelial monolayer at intercellular junctions in vascular tissue. Its expression may allow melanoma cells to interact with cellular elements of the vascular system, thereby enhancing hematogeneous tumor spread. Could be an adhesion molecule active in neural crest cells during embryonic development. Acts as surface receptor that triggers tyrosine phosphorylation of FYN and PTK2/FAK1, and a transient increase in the intracellular calcium concentration.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000264036
  • ENSP00000264036
  • ENSG00000076706

Symbol
  • MUC18
  • CD146
  • MUC18
  • HEMCAM
  • METCAM
  • MelCAM
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.99
PubMedID
0.98
transcription factor perturbation
0.98
disease perturbation
0.96
disease
0.95


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 642.63   (req: < 5)
Gene RIFs: 137   (req: <= 3)
Antibodies: 1686   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 642.63   (req: >= 5)
Gene RIFs: 137   (req: > 3)
Antibodies: 1686   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (13)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from High Throughput Direct Assay (HDA)
BHF-UCL
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Non-traceable Author Statement (NAS)
ProtInc
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (110)
1 – 10 of 110
LAMA4
Tbio
Novelty: 0.02106699
p_int: 0.999997976
p_ni: 0.000002023
Score: 0.861
Data Source: BioPlex,STRINGDB
CST5
Tbio
Novelty: 0.05255793
p_int: 0.999996857
p_ni: 0.000003114
p_wrong: 2.9e-8
Data Source: BioPlex
CNTN1
Tbio
Novelty: 0.00985138
p_int: 0.997079633
p_ni: 0.002920367
Score: 0.21
Data Source: BioPlex,STRINGDB
ATP6V0A2
Tbio
Family: Enzyme
Novelty: 0.0033925
p_int: 0.964877738
p_ni: 0.035122262
Score: 0.565
Data Source: BioPlex,STRINGDB
LGALS8
Tchem
Novelty: 0.00746585
p_int: 0.947653323
p_ni: 0.003489095
p_wrong: 0.048857583
Score: 0.536
Data Source: BioPlex,STRINGDB
ATP6V0A1
Tbio
Family: Enzyme
Novelty: 0.03404906
p_int: 0.877322856
p_ni: 0.122677144
Score: 0.733
Data Source: BioPlex,STRINGDB
ENG
Tbio
Novelty: 0.00068902
Score: 0.874
Data Source: STRINGDB
THY1
Tbio
Novelty: 0.00046162
Score: 0.857
Data Source: STRINGDB
NT5E
Tchem
Family: Enzyme
Novelty: 0.00121213
Score: 0.843
Data Source: STRINGDB
CD34
Tbio
Novelty: 0.00007032
Score: 0.818
Data Source: STRINGDB
Publication Statistics
PubMed Score  642.63

PubMed score by year
PubTator Score  449.89

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGLPRLVCAFLLAACCCCPRVAGVPGEAEQPAPELVEVEVGSTALLKCGLSQSQGNLSHVDWFSVHKEKR
1-70
TLIFRVRQGQGQSEPGEYEQRLSLQDRGATLALTQVTPQDERIFLCQGKRPRSQEYRIQLRVYKAPEEPN
70-140
IQVNPLGIPVNSKEPEEVATCVGRNGYPIPQVIWYKNGRPLKEEKNRVHIQSSQTVESSGLYTLQSILKA
140-210
QLVKEDKDAQFYCELNYRLPSGNHMKESREVTVPVFYPTEKVWLEVEPVGMLKEGDRVEIRCLADGNPPP
210-280
HFSISKQNPSTREAEEETTNDNGVLVLEPARKEHSGRYECQGLDLDTMISLLSEPQELLVNYVSDVRVSP
280-350
AAPERQEGSSLTLTCEAESSQDLEFQWLREETGQVLERGPVLQLHDLKREAGGGYRCVASVPSIPGLNRT
350-420
QLVNVAIFGPPWMAFKERKVWVKENMVLNLSCEASGHPRPTISWNVNGTASEQDQDPQRVLSTLNVLVTP
420-490
ELLETGVECTASNDLGKNTSILFLELVNLTTLTPDSNTTTGLSTSTASPHTRANSTSTERKLPEPESRGV
490-560
VIVAVIVCILVLAVLGAVLYFLYKKGKLPCRRSGKQEITLPPSRKSELVVEVKSDKLPEEMGLLQGSSGD
560-630
KRAPGDQGEKYIDLRH
630-646
MGLPRLVCAFLLAACCCCPRVAGVPGEAEQPAPELVEVEVGSTALLKCGLSQSQGNLSHVDWFSVHKEKRTLIFRVRQGQGQSEPGEYEQRLSLQDRGATLALTQVTPQDERIFLCQGKRPRSQEYRIQLRVYKAPEEPNIQVNPLGIPVNSKEPEEVATCVGRNGYPIPQVIWYKNGRPLKEEKNRVHIQSSQTVESSGLYTLQSILKAQLVKEDKDAQFYCELNYRLPSGNHMKESREVTVPVFYPTEKVWLEVEPVGMLKEGDRVEIRCLADGNPPPHFSISKQNPSTREAEEETTNDNGVLVLEPARKEHSGRYECQGLDLDTMISLLSEPQELLVNYVSDVRVSPAAPERQEGSSLTLTCEAESSQDLEFQWLREETGQVLERGPVLQLHDLKREAGGGYRCVASVPSIPGLNRTQLVNVAIFGPPWMAFKERKVWVKENMVLNLSCEASGHPRPTISWNVNGTASEQDQDPQRVLSTLNVLVTPELLETGVECTASNDLGKNTSILFLELVNLTTLTPDSNTTTGLSTSTASPHTRANSTSTERKLPEPESRGVVIVAVIVCILVLAVLGAVLYFLYKKGKLPCRRSGKQEITLPPSRKSELVVEVKSDKLPEEMGLLQGSSGDKRAPGDQGEKYIDLRH