You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
PTGER3
Prostaglandin E2 receptor EP3 subtype

Protein Summary
Description
Receptor for prostaglandin E2 (PGE2) (PubMed:8307176, PubMed:7883006, PubMed:8117308, PubMed:8135729, PubMed:7981210). The activity of this receptor can couple to both the inhibition of adenylate cyclase mediated by G(i) proteins, and to an elevation of intracellular calcium (PubMed:7883006, PubMed:8117308, PubMed:8135729, PubMed:7981210). Required for normal development of fever in response to pyrinogens, including IL1B, prostaglandin E2 and bacterial lipopolysaccharide (LPS). Required for normal potentiation of platelet aggregation by prostaglandin E2, and thus plays a role in the regulation of blood coagulation. Required for increased HCO3(-) secretion in the duodenum in response to mucosal acidification, and thereby contributes to the protection of the mucosa against acid-induced ulceration. Not required for normal kidney function, normal urine volume and osmolality (By similarity). The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000306666
  • ENSP00000302313
  • ENSG00000050628
  • ENST00000351052
  • ENSP00000280208
  • ENST00000356595
  • ENSP00000349003
  • ENST00000370924
  • ENSP00000359962
  • ENST00000370931
  • ENSP00000359969
  • ENST00000460330
  • ENSP00000418073
  • ENST00000479353
  • ENSP00000421583
  • ENST00000628037
  • ENSP00000486617

Symbol
  • EP3
  • EP3e
  • EP3-I
  • EP3-II
  • EP3-IV
  • EP3-VI
  • PGE2-R
  • EP3-III
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
PubMedID
0.99
ligand (chemical)
0.97
disease perturbation
0.95
microRNA
0.87
protein domain
0.85


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 642.58   (req: < 5)
Gene RIFs: 66   (req: <= 3)
Antibodies: 420   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 642.58   (req: >= 5)
Gene RIFs: 66   (req: > 3)
Antibodies: 420   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 414
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 5
Pathways (17)
Class A/1 (Rhodopsin-like receptors) (R-HSA-373076)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
Eicosanoid ligand-binding receptors
Reactome
G alpha (i) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Name
Explore in Pharos
Explore in Source
Class A/1 (Rhodopsin-like receptors)
Eicosanoid ligand-binding receptors
G alpha (i) signalling events
GPCR downstream signalling
GPCR ligand binding
Gene Ontology Terms (14)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (332)
1 – 10 of 332
TMED8
Tdark
p_int: 0.99994186
p_ni: 0.000058135
p_wrong: 5e-9
Data Source: BioPlex
PLCB1
Tbio
Family: Enzyme
Novelty: 0.00309091
p_int: 0.999936935
p_ni: 0.000023609
p_wrong: 0.000039456
Score: 0.23
Data Source: BioPlex,STRINGDB
PKN3
Tbio
Family: Kinase
Novelty: 0.06193995
p_int: 0.999850164
p_ni: 0.000149836
Data Source: BioPlex
RHBDF2
Tbio
Family: Enzyme
Novelty: 0.02152024
p_int: 0.999712933
p_ni: 0.000286586
p_wrong: 4.81e-7
Data Source: BioPlex
HOOK2
Tbio
Novelty: 0.05566712
p_int: 0.999580914
p_ni: 0.000419086
Data Source: BioPlex
CWC22
Tbio
Novelty: 0.00359581
p_int: 0.999327127
p_ni: 0.000672872
Data Source: BioPlex
PPP1R15B
Tbio
Family: Enzyme
Novelty: 0.03268691
p_int: 0.999306246
p_ni: 0.00069156
p_wrong: 0.000002194
Data Source: BioPlex
MYADM
Tbio
Novelty: 0.09214874
p_int: 0.999124332
p_ni: 0.000873849
p_wrong: 0.000001819
Data Source: BioPlex
TYW1B
Tdark
Family: Enzyme
p_int: 0.999107412
p_ni: 0.000892588
Data Source: BioPlex
ANKRD13D
Tdark
p_int: 0.998559608
p_ni: 0.001440391
p_wrong: 1e-9
Data Source: BioPlex
Publication Statistics
PubMed Score  642.58

PubMed score by year
PubTator Score  223.47

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVAFPITMLLTGFVGNALAM
1-70
LLVSRSYRRRESKRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRWEHIDPSGRLCTFFGLTMTVF
70-140
GLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLGVWLAVLAFALLPVLGVGQYTVQWPGTWCFI
140-210
STGRGGNGTSSSHNWGNLFFASAFAFLGLLALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRITTET
210-280
AIQLMGIMCVLSVCWSPLLIMMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLR
280-350
KILLRKFCQIRYHTNNYASSSTSLPCQCSSTLMWSDHLER
350-390
MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVAFPITMLLTGFVGNALAMLLVSRSYRRRESKRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRWEHIDPSGRLCTFFGLTMTVFGLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLGVWLAVLAFALLPVLGVGQYTVQWPGTWCFISTGRGGNGTSSSHNWGNLFFASAFAFLGLLALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLIMMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQIRYHTNNYASSSTSLPCQCSSTLMWSDHLER