You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
SLC1A2
Excitatory amino acid transporter 2

Protein Summary
Description
Sodium-dependent, high-affinity amino acid transporter that mediates the uptake of L-glutamate and also L-aspartate and D-aspartate (PubMed:7521911, PubMed:14506254, PubMed:15265858, PubMed:26690923). Functions as a symporter that transports one amino acid molecule together with two or three Na(+) ions and one proton, in parallel with the counter-transport of one K(+) ion (PubMed:14506254). Mediates Cl(-) flux that is not coupled to amino acid transport; this avoids the accumulation of negative charges due to aspartate and Na(+) symport (PubMed:14506254). Essential for the rapid removal of released glutamate from the synaptic cleft, and for terminating the postsynaptic action of glutamate (By similarity). This gene encodes a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000278379
  • ENSP00000278379
  • ENSG00000110436
  • ENST00000395753
  • ENSP00000379102
  • ENST00000643000
  • ENSP00000495164
  • ENST00000643305
  • ENSP00000494828
  • ENST00000644050
  • ENSP00000496123
  • ENST00000644299
  • ENSP00000494669
  • ENST00000645194
  • ENSP00000496093
  • ENST00000645634
  • ENSP00000493945
  • ENST00000647104
  • ENSP00000494025

Symbol
  • EAAT2
  • GLT1
  • HBGT
  • EAAT2
  • GLT-1
  • EIEE41
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
hub protein
0.98
molecular function
0.96
microRNA
0.8
disease
0.78
PubMedID
0.77


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1006.6   (req: < 5)
Gene RIFs: 103   (req: <= 3)
Antibodies: 265   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1006.6   (req: >= 5)
Gene RIFs: 103   (req: > 3)
Antibodies: 265   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 22
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 33
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (33)
1 – 10 of 33
CHEMBL288166
chemical structure image
CHEMBL79140
chemical structure image
[<sup>3</sup>H]ETB-TBOA
chemical structure image
CHEMBL1628570
chemical structure image
CHEMBL1628669
chemical structure image
CHEMBL2113116
chemical structure image
CHEMBL2113117
chemical structure image
CHEMBL2113118
chemical structure image
CHEMBL2113115
chemical structure image
CHEMBL2113123
chemical structure image
Pathways (68)
Astrocytic Glutamate-Glutamine Uptake And Metabolism (R-HSA-210455)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 9
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Astrocytic Glutamate-Glutamine Uptake And Metabolism
Reactome
Glutamate Neurotransmitter Release Cycle
Reactome
Neuronal System
Reactome
Neurotransmitter release cycle
Reactome
Neurotransmitter uptake and metabolism In glial cells
Name
Explore in Pharos
Explore in Source
Astrocytic Glutamate-Glutamine Uptake And Metabolism
Glutamate Neurotransmitter Release Cycle
Neuronal System
Neurotransmitter release cycle
Neurotransmitter uptake and metabolism In glial cells
Gene Ontology Terms (29)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
BHF-UCL
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (194)
1 – 10 of 194
AQP4
Tbio
Novelty: 0.00040544
Score: 0.887
Data Source: STRINGDB
RPL32
Tbio
Novelty: 0.00584751
Score: 0.869
Data Source: STRINGDB
SLC1A3
Tchem
Family: Transporter
Novelty: 0.00170013
Score: 0.84
Data Source: STRINGDB
GLUL
Tchem
Family: Enzyme
Novelty: 0.00112575
Score: 0.837
Data Source: STRINGDB
RPL3
Tbio
Novelty: 0.00906457
Score: 0.828
Data Source: STRINGDB
RPL23A
Tbio
Novelty: 0.03695788
Score: 0.827
Data Source: STRINGDB
RPL17
Tbio
Novelty: 0.06372809
Score: 0.806
Data Source: STRINGDB
SLC6A1
Tclin
Family: Transporter
Novelty: 0.0014418
Score: 0.803
Data Source: STRINGDB
FAM171B
Tdark
Novelty: 0.51724138
Score: 0.798
Data Source: STRINGDB
GFAP
Tbio
Novelty: 0.00029784
Score: 0.787
Data Source: STRINGDB
Publication Statistics
PubMed Score  1006.60

PubMed score by year
PubTator Score  453.75

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MASTEGANNMPKQVEVRMHDSHLGSEEPKHRHLGLRLCDKLGKNLLLTLTVFGVILGAVCGGLLRLASPI
1-70
HPDVVMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRAMVYYMSTTIIAAVLGVILVL
70-140
AIHPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSA
140-210
VVSLLNETVTEVPEETKMVIKKGLEFKDGMNVLGLIGFFIAFGIAMGKMGDQAKLMVDFFNILNEIVMKL
210-280
VIMIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMVTVIIGLIIHGGIFLPLIYFVVTRKNPFSFFAG
280-350
IFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVL
350-420
DGGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGA
420-490
GIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDECKVTLAANGKS
490-560
ADCSVEEEPWKREK
560-574
MASTEGANNMPKQVEVRMHDSHLGSEEPKHRHLGLRLCDKLGKNLLLTLTVFGVILGAVCGGLLRLASPIHPDVVMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRAMVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGMNVLGLIGFFIAFGIAMGKMGDQAKLMVDFFNILNEIVMKLVIMIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMVTVIIGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVLDGGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDECKVTLAANGKSADCSVEEEPWKREK