You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
SLC1A3
Excitatory amino acid transporter 1

Protein Summary
Description
Sodium-dependent, high-affinity amino acid transporter that mediates the uptake of L-glutamate and also L-aspartate and D-aspartate (PubMed:7521911, PubMed:8123008, PubMed:20477940, PubMed:26690923, PubMed:28032905, PubMed:28424515). Functions as a symporter that transports one amino acid molecule together with two or three Na(+) ions and one proton, in parallel with the counter-transport of one K(+) ion (PubMed:20477940). Mediates Cl(-) flux that is not coupled to amino acid transport; this avoids the accumulation of negative charges due to aspartate and Na(+) symport (PubMed:20477940). Plays a redundant role in the rapid removal of released glutamate from the synaptic cleft, which is essential for terminating the postsynaptic action of glutamate (By similarity). This gene encodes a member of a member of a high affinity glutamate transporter family. This gene functions in the termination of excitatory neurotransmission in central nervous system. Mutations are associated with episodic ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000265113
  • ENSP00000265113
  • ENSG00000079215
  • ENST00000381918
  • ENSP00000371343

Symbol
  • EAAT1
  • GLAST
  • GLAST1
  • EA6
  • EAAT1
  • GLAST
  • GLAST1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.98
PubMedID
0.9
biological process
0.87
interacting protein
0.76
virus perturbation
0.76


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 583.75   (req: < 5)
Gene RIFs: 67   (req: <= 3)
Antibodies: 360   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 583.75   (req: >= 5)
Gene RIFs: 67   (req: > 3)
Antibodies: 360   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 28
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 23
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (23)
1 – 10 of 23
CHEMBL474133
chemical structure image
CHEMBL79140
chemical structure image
[<sup>3</sup>H]ETB-TBOA
chemical structure image
CHEMBL3960774
chemical structure image
CHEMBL1628570
chemical structure image
CHEMBL2113117
chemical structure image
CHEMBL2113118
chemical structure image
CHEMBL2113115
chemical structure image
CHEMBL1259233
chemical structure image
CHEMBL2113123
chemical structure image
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (29)
Astrocytic Glutamate-Glutamine Uptake And Metabolism (R-HSA-210455)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 13
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Astrocytic Glutamate-Glutamine Uptake And Metabolism
Reactome
Defective SLC1A3 causes episodic ataxia 6 (EA6)
Reactome
Disease
Reactome
Disorders of transmembrane transporters
Reactome
Glutamate Neurotransmitter Release Cycle
Name
Explore in Pharos
Explore in Source
Astrocytic Glutamate-Glutamine Uptake And Metabolism
Defective SLC1A3 causes episodic ataxia 6 (EA6)
Disease
Disorders of transmembrane transporters
Glutamate Neurotransmitter Release Cycle
Gene Ontology Terms (34)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
BHF-UCL
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (135)
1 – 10 of 135
PDZK1P1
Tdark
p_int: 0.891083942
p_ni: 0.108916058
Data Source: BioPlex
GLUL
Tchem
Family: Enzyme
Novelty: 0.00112575
Score: 0.849
Data Source: STRINGDB
SLC1A2
Tchem
Family: Transporter
Novelty: 0.00102084
Score: 0.84
Data Source: STRINGDB
GFAP
Tbio
Novelty: 0.00029784
Score: 0.81
Data Source: STRINGDB
AQP4
Tbio
Novelty: 0.00040544
Score: 0.752
Data Source: STRINGDB
FABP7
Tbio
Novelty: 0.00601089
Score: 0.747
Data Source: STRINGDB
SLC38A2
Tbio
Family: Transporter
Novelty: 0.01178113
Score: 0.735
Data Source: STRINGDB
SLC6A1
Tclin
Family: Transporter
Novelty: 0.0014418
Score: 0.705
Data Source: STRINGDB
ALDH1L1
Tbio
Family: Enzyme
Novelty: 0.01528531
Score: 0.704
Data Source: STRINGDB
KCNJ10
Tbio
Family: IC
Novelty: 0.00337611
Score: 0.682
Data Source: STRINGDB
Publication Statistics
PubMed Score  583.75

PubMed score by year
PubTator Score  278.84

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTKSNGEEPKMGGRMERFQQGVRKRTLLAKKKVQNITKEDVKSYLFRNAFVLLTVTAVIVGTILGFTLRP
1-70
YRMSYREVKYFSFPGELLMRMLQMLVLPLIISSLVTGMAALDSKASGKMGMRAVVYYMTTTIIAVVIGII
70-140
IVIIIHPGKGTKENMHREGKIVRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLV
140-210
GAVINNVSEAMETLTRITEELVPVPGSVNGVNALGLVVFSMCFGFVIGNMKEQGQALREFFDSLNEAIMR
210-280
LVAVIMWYAPVGILFLIAGKIVEMEDMGVIGGQLAMYTVTVIVGLLIHAVIVLPLLYFLVTRKNPWVFIG
280-350
GLLQALITALGTSSSSATLPITFKCLEENNGVDKRVTRFVLPVGATINMDGTALYEALAAIFIAQVNNFE
350-420
LNFGQIITISITATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWFLDRLRTTTNVLGDSLG
420-490
AGIVEHLSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSETKM
490-542
MTKSNGEEPKMGGRMERFQQGVRKRTLLAKKKVQNITKEDVKSYLFRNAFVLLTVTAVIVGTILGFTLRPYRMSYREVKYFSFPGELLMRMLQMLVLPLIISSLVTGMAALDSKASGKMGMRAVVYYMTTTIIAVVIGIIIVIIIHPGKGTKENMHREGKIVRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPGSVNGVNALGLVVFSMCFGFVIGNMKEQGQALREFFDSLNEAIMRLVAVIMWYAPVGILFLIAGKIVEMEDMGVIGGQLAMYTVTVIVGLLIHAVIVLPLLYFLVTRKNPWVFIGGLLQALITALGTSSSSATLPITFKCLEENNGVDKRVTRFVLPVGATINMDGTALYEALAAIFIAQVNNFELNFGQIITISITATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWFLDRLRTTTNVLGDSLGAGIVEHLSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSETKM