You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
ECE1
Endothelin-converting enzyme 1

Protein Summary
Description
Converts big endothelin-1 to endothelin-1. The protein encoded by this gene is involved in proteolytic processing of endothelin precursors to biologically active peptides. Mutations in this gene are associated with Hirschsprung disease, cardiac defects and autonomic dysfunction. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.[provided by RefSeq, Sep 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000264205
  • ENSP00000264205
  • ENSG00000117298
  • ENST00000357071
  • ENSP00000349581
  • ENST00000374893
  • ENSP00000364028
  • ENST00000415912
  • ENSP00000405088

Symbol
  • ECE
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cellular component
0.9
ligand (protein) perturbation
0.83
kinase perturbation
0.76
transcription factor binding site profile
0.74
protein domain
0.73


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 383.26   (req: < 5)
Gene RIFs: 70   (req: <= 3)
Antibodies: 377   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 383.26   (req: >= 5)
Gene RIFs: 70   (req: > 3)
Antibodies: 377   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 19
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 257
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
racecadotril
chemical structure image
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (10)
Class A/1 (Rhodopsin-like receptors) (R-HSA-373076)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
GPCR ligand binding
Reactome
Peptide ligand-binding receptors
Reactome
Signal Transduction
Reactome
Signaling by GPCR
Name
Explore in Pharos
Explore in Source
Class A/1 (Rhodopsin-like receptors)
GPCR ligand binding
Peptide ligand-binding receptors
Signal Transduction
Signaling by GPCR
Protein-Protein Interactions (58)
1 – 10 of 58
LGALS9
Tchem
Novelty: 0.00463223
p_int: 0.967194
p_ni: 0.032806
Score: 0.215
Data Source: BioPlex,STRINGDB
LGALS8
Tchem
Novelty: 0.00746585
p_int: 0.945106604
p_ni: 0.054893396
Score: 0.174
Data Source: BioPlex,STRINGDB
PTPRK
Tbio
Family: Enzyme
Novelty: 0.03472453
p_int: 0.919349683
p_ni: 0.080650316
p_wrong: 1e-9
Score: 0.514
Data Source: BioPlex,STRINGDB
NPB
Tdark
Novelty: 0.00254878
p_int: 0.91301175
p_ni: 0.08698825
Score: 0.183
Data Source: BioPlex,STRINGDB
EDDM3A
Tdark
Novelty: 0.08885024
p_int: 0.880584296
p_ni: 0.119415704
Data Source: BioPlex
LGALS3
Tchem
Novelty: 0.00032884
p_int: 0.875761244
p_ni: 0.124238756
Score: 0.264
Data Source: BioPlex,STRINGDB
PATE1
Tbio
Novelty: 0.03158921
p_int: 0.864925428
p_ni: 0.135074572
Data Source: BioPlex
FUT3
Tbio
Family: Enzyme
Novelty: 0.00272149
p_int: 0.856644266
p_ni: 0.143355734
Score: 0.181
Data Source: BioPlex,STRINGDB
SUSD4
Tbio
Novelty: 0.13953488
p_int: 0.824721613
p_ni: 0.175278387
Data Source: BioPlex
SPAG11B
Tbio
Novelty: 0.11942279
p_int: 0.819079652
p_ni: 0.180920348
Data Source: BioPlex
Publication Statistics
PubMed Score  383.26

PubMed score by year
PubTator Score  382.77

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRGVWPPPVSALLSALGMSTYKRATLDEEDLVDSLSEGDAYPNGLQVNFHSPRSGQRCWAARTQVEKRLV
1-70
VLVVLLAAGLVACLAALGIQYQTRSPSVCLSEACVSVTSSILSSMDPTVDPCHDFFSYACGGWIKANPVP
70-140
DGHSRWGTFSNLWEHNQAIIKHLLENSTASVSEAERKAQVYYRACMNETRIEELRAKPLMELIERLGGWN
140-210
ITGPWAKDNFQDTLQVVTAHYRTSPFFSVYVSADSKNSNSNVIQVDQSGLGLPSRDYYLNKTENEKVLTG
210-280
YLNYMVQLGKLLGGGDEEAIRPQMQQILDFETALANITIPQEKRRDEELIYHKVTAAELQTLAPAINWLP
280-350
FLNTIFYPVEINESEPIVVYDKEYLEQISTLINTTDRCLLNNYMIWNLVRKTSSFLDQRFQDADEKFMEV
350-420
MYGTKKTCLPRWKFCVSDTENNLGFALGPMFVKATFAEDSKSIATEIILEIKKAFEESLSTLKWMDEETR
420-490
KSAKEKADAIYNMIGYPNFIMDPKELDKVFNDYTAVPDLYFENAMRFFNFSWRVTADQLRKAPNRDQWSM
490-560
TPPMVNAYYSPTKNEIVFPAGILQAPFYTRSSPKALNFGGIGVVVGHELTHAFDDQGREYDKDGNLRPWW
560-630
KNSSVEAFKRQTECMVEQYSNYSVNGEPVNGRHTLGENIADNGGLKAAYRAYQNWVKKNGAEHSLPTLGL
630-700
TNNQLFFLGFAQVWCSVRTPESSHEGLITDPHSPSRFRVIGSLSNSKEFSEHFRCPPGSPMNPPHKCEVW
700-770
MRGVWPPPVSALLSALGMSTYKRATLDEEDLVDSLSEGDAYPNGLQVNFHSPRSGQRCWAARTQVEKRLVVLVVLLAAGLVACLAALGIQYQTRSPSVCLSEACVSVTSSILSSMDPTVDPCHDFFSYACGGWIKANPVPDGHSRWGTFSNLWEHNQAIIKHLLENSTASVSEAERKAQVYYRACMNETRIEELRAKPLMELIERLGGWNITGPWAKDNFQDTLQVVTAHYRTSPFFSVYVSADSKNSNSNVIQVDQSGLGLPSRDYYLNKTENEKVLTGYLNYMVQLGKLLGGGDEEAIRPQMQQILDFETALANITIPQEKRRDEELIYHKVTAAELQTLAPAINWLPFLNTIFYPVEINESEPIVVYDKEYLEQISTLINTTDRCLLNNYMIWNLVRKTSSFLDQRFQDADEKFMEVMYGTKKTCLPRWKFCVSDTENNLGFALGPMFVKATFAEDSKSIATEIILEIKKAFEESLSTLKWMDEETRKSAKEKADAIYNMIGYPNFIMDPKELDKVFNDYTAVPDLYFENAMRFFNFSWRVTADQLRKAPNRDQWSMTPPMVNAYYSPTKNEIVFPAGILQAPFYTRSSPKALNFGGIGVVVGHELTHAFDDQGREYDKDGNLRPWWKNSSVEAFKRQTECMVEQYSNYSVNGEPVNGRHTLGENIADNGGLKAAYRAYQNWVKKNGAEHSLPTLGLTNNQLFFLGFAQVWCSVRTPESSHEGLITDPHSPSRFRVIGSLSNSKEFSEHFRCPPGSPMNPPHKCEVW