You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
FRK
Tyrosine-protein kinase FRK

Protein Summary
Description
Non-receptor tyrosine-protein kinase that negatively regulates cell proliferation. Positively regulates PTEN protein stability through phosphorylation of PTEN on 'Tyr-336', which in turn prevents its ubiquitination and degradation, possibly by reducing its binding to NEDD4. May function as a tumor suppressor. The protein encoded by this gene belongs to the TYR family of protein kinases. This tyrosine kinase is a nuclear protein and may function during G1 and S phase of the cell cycle and suppress growth. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000606080
  • ENSP00000476145
  • ENSG00000111816

Symbol
  • PTK5
  • RAK
  • GTK
  • RAK
  • PTK5
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.97
molecular function
0.94
virus perturbation
0.76
gene perturbation
0.62
PubMedID
0.58


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 68.95   (req: < 5)
Gene RIFs: 17   (req: <= 3)
Antibodies: 517   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 68.95   (req: >= 5)
Gene RIFs: 17   (req: > 3)
Antibodies: 517   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 11
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 7
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 2
Approved Drugs (2)
1 – 2 of 2
dasatinib
chemical structure image
bosutinib
chemical structure image
Pathways (12)
Immune System (R-HSA-168256)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Immune System
Reactome
Innate Immune System
Reactome
Intracellular signaling by second messengers
Reactome
Neutrophil degranulation
Reactome
PIP3 activates AKT signaling
Name
Explore in Pharos
Explore in Source
Immune System
Innate Immune System
Intracellular signaling by second messengers
Neutrophil degranulation
PIP3 activates AKT signaling
Protein-Protein Interactions (201)
1 – 10 of 201
PCBP1
Tbio
Novelty: 0.01171416
p_int: 1
Score: 0.521
Data Source: BioPlex,STRINGDB
CSK
Tchem
Family: Kinase
Novelty: 0.00233206
p_int: 0.999995858
p_ni: 0.000001175
p_wrong: 0.000002967
Score: 0.821
Data Source: BioPlex,STRINGDB
PTEN
Tchem
Family: Enzyme
Novelty: 0.00017995
Score: 0.956
Data Source: Reactome,STRINGDB
MAPK1
Tchem
Family: Kinase
Novelty: 0.00046573
Score: 0.934
Data Source: STRINGDB
VCL
Tbio
Novelty: 0.00044707
Score: 0.932
Data Source: STRINGDB
JUP
Tbio
Novelty: 0.01122537
Score: 0.921
Data Source: STRINGDB
PTPN6
Tchem
Family: Enzyme
Novelty: 0.00619412
Score: 0.919
Data Source: STRINGDB
LRRC7
Tbio
Novelty: 0.03494034
Score: 0.914
Data Source: STRINGDB
DPP7
Tchem
Family: Enzyme
Novelty: 0.00564941
Score: 0.913
Data Source: STRINGDB
C3
Tbio
Novelty: 0.00025052
Score: 0.912
Data Source: STRINGDB
Publication Statistics
PubMed Score  68.95

PubMed score by year
PubTator Score  83.94

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MSNICQRLWEYLEPYLPCLSTEADKSTVIENPGALCSPQSQRHGHYFVALFDYQARTAEDLSFRAGDKLQ
1-70
VLDTLHEGWWFARHLEKRRDGSSQQLQGYIPSNYVAEDRSLQAEPWFFGAIGRSDAEKQLLYSENKTGSF
70-140
LIRESESQKGEFSLSVLDGAVVKHYRIKRLDEGGFFLTRRRIFSTLNEFVSHYTKTSDGLCVKLGKPCLK
140-210
IQVPAPFDLSYKTVDQWEIDRNSIQLLKRLGSGQFGEVWEGLWNNTTPVAVKTLKPGSMDPNDFLREAQI
210-280
MKNLRHPKLIQLYAVCTLEDPIYIITELMRHGSLQEYLQNDTGSKIHLTQQVDMAAQVASGMAYLESRNY
280-350
IHRDLAARNVLVGEHNIYKVADFGLARVFKVDNEDIYESRHEIKLPVKWTAPEAIRSNKFSIKSDVWSFG
350-420
ILLYEIITYGKMPYSGMTGAQVIQMLAQNYRLPQPSNCPQQFYNIMLECWNAEPKERPTFETLRWKLEDY
420-490
FETDSSYSDANNFIR
490-505
MSNICQRLWEYLEPYLPCLSTEADKSTVIENPGALCSPQSQRHGHYFVALFDYQARTAEDLSFRAGDKLQVLDTLHEGWWFARHLEKRRDGSSQQLQGYIPSNYVAEDRSLQAEPWFFGAIGRSDAEKQLLYSENKTGSFLIRESESQKGEFSLSVLDGAVVKHYRIKRLDEGGFFLTRRRIFSTLNEFVSHYTKTSDGLCVKLGKPCLKIQVPAPFDLSYKTVDQWEIDRNSIQLLKRLGSGQFGEVWEGLWNNTTPVAVKTLKPGSMDPNDFLREAQIMKNLRHPKLIQLYAVCTLEDPIYIITELMRHGSLQEYLQNDTGSKIHLTQQVDMAAQVASGMAYLESRNYIHRDLAARNVLVGEHNIYKVADFGLARVFKVDNEDIYESRHEIKLPVKWTAPEAIRSNKFSIKSDVWSFGILLYEIITYGKMPYSGMTGAQVIQMLAQNYRLPQPSNCPQQFYNIMLECWNAEPKERPTFETLRWKLEDYFETDSSYSDANNFIR